JOYAS DE PLATA

Utilizamos cookies propias y de terceros para mejorar nuestros servicios y mostrarle publicidad

relacionada con sus preferencias mediante el análisis de sus hábitos de navegación. Puede

consultar nuestra Política de cookies  aquí

Load Time 882 ms
Querying Time 341 ms
Queries 806
Memory Peak Usage 25.0 Mb
Included Files 1201 files - 11.79 Mb
PrestaShop Cache - Mb
Global vars 0.25 Mb
PrestaShop Version 8.2.4
PHP Version 8.2.30
MySQL Version 10.3.39-MariaDB
Memory Limit 524M
Max Execution Time 120s
Smarty Cache enabled
Smarty Compilation never recompile
  Time Cumulated Time Memory Usage Memory Peak Usage
config 54.889 ms 54.889 ms 3.06 Mb 3.1 Mb
__construct 1.567 ms 56.456 ms - Mb 3.6 Mb
init 18.718 ms 75.174 ms 1.16 Mb 4.2 Mb
checkAccess 0.001 ms 75.175 ms - Mb 4.2 Mb
setMedia 2.612 ms 77.787 ms 0.12 Mb 4.3 Mb
postProcess 0.001 ms 77.788 ms - Mb 4.3 Mb
initHeader 0.002 ms 77.790 ms - Mb 4.3 Mb
initContent 694.772 ms 772.562 ms 15.61 Mb 20.0 Mb
initFooter 0.002 ms 772.564 ms - Mb 20.0 Mb
display 109.279 ms 882 ms 4.52 Mb 25.0 Mb
Hook Time Memory Usage
DisplayHeader 401.673 ms 4.78 Mb
displayNav1 15.186 ms 0.14 Mb
DisplayBeforeBodyClosingTag 13.967 ms 0.16 Mb
displayFooter 5.852 ms 0.41 Mb
ProductSearchProvider 1.964 ms 0.18 Mb
DisplayGDPRConsent 1.535 ms 0.11 Mb
displayMainMenu 1.488 ms 0.23 Mb
displayAfterBreadcrumb 1.382 ms 0.03 Mb
displayBeforeBodyClosingTag 1.375 ms 0.05 Mb
DisplayFooter 1.280 ms 0.06 Mb
displayNav2 0.617 ms 0.08 Mb
DisplayLeftColumn 0.479 ms 0.04 Mb
ActionFrontControllerSetMedia 0.378 ms 0.01 Mb
IsJustElementor 0.178 ms 0.02 Mb
displayVerticalMenu 0.013 ms - Mb
ActionDispatcher 0.011 ms - Mb
ActionProductSearchAfter 0.004 ms - Mb
Header 0.004 ms - Mb
18 hook(s) 447.387 ms 6.29 Mb
Module Time Memory Usage
iqitthemeeditor 1.405 ms 0.12 Mb
ps_emailsubscription 5.248 ms 0.42 Mb
ps_facebook 399.370 ms 4.61 Mb
ps_emailalerts 0.199 ms 0.04 Mb
productcomments 0.347 ms 0.03 Mb
ps_shoppingcart 0.151 ms 0.02 Mb
ps_accounts 1.712 ms 0.03 Mb
psxmarketingwithgoogle 2.575 ms 0.17 Mb
iqitcookielaw 2.431 ms 0.12 Mb
iqitmegamenu 6.648 ms 1.08 Mb
iqitelementor 7.647 ms 1.01 Mb
nacex 13.659 ms 2.03 Mb
ps_facetedsearch 7.414 ms 0.71 Mb
iqitlinksmanager 17.721 ms 0.30 Mb
ps_languageselector 0.620 ms 0.07 Mb
ps_currencyselector 0.588 ms 0.07 Mb
iqitsearch 0.538 ms 0.04 Mb
ps_customersignin 0.228 ms 0.02 Mb
iqitproductsnav 2.110 ms 0.07 Mb
corewhatsapp 1.964 ms 0.12 Mb
psgdpr 3.746 ms 0.32 Mb
statsdata 14.131 ms 0.18 Mb
22 module(s) 490.452 ms 11.57 Mb

Stopwatch SQL - 806 queries

# Query Time (ms) Rows Filesort Group By Location
389
SELECT SQL_NO_CACHE cp.id_category, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' GROUP BY p.id_product) p INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE cg.id_group='1' AND c.nleft>103 AND c.nright<152 GROUP BY cp.id_category
47.006 ms 16102 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
385
SELECT SQL_NO_CACHE p.id_product FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND cp.id_category IN (52, 51, 53, 49, 46) GROUP BY p.id_product) p GROUP BY p.id_product ORDER BY p.date_add DESC, p.id_product DESC
14.097 ms 1760929 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
740
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 2521
ORDER BY `position`
14.095 ms 1 Yes /classes/Product.php:3539
761
SELECT SQL_NO_CACHE COUNT(DISTINCT c.id_currency) FROM `prstshp_currency` c
LEFT JOIN prstshp_currency_shop cs ON (cs.id_currency = c.id_currency AND cs.id_shop = 1)
WHERE c.`active` = 1 AND c.`deleted` = 0 LIMIT 1
12.502 ms 2 /classes/Currency.php:1134
390
REPLACE INTO prstshp_layered_filter_block (hash, data) VALUES ("938355e22b17137bcfe731b203709892", "a:1:{s:7:\"filters\";a:2:{i:0;a:12:{s:9:\"type_lite\";s:5:\"price\";s:4:\"type\";s:5:\"price\";s:6:\"id_key\";i:0;s:4:\"name\";s:6:\"Precio\";s:3:\"max\";d:475;s:3:\"min\";d:8;s:4:\"unit\";s:3:\"€\";s:14:\"specifications\";a:11:{s:6:\"symbol\";a:11:{i:0;s:1:\",\";i:1;s:1:\".\";i:2;s:1:\";\";i:3;s:1:\"%\";i:4;s:1:\"-\";i:5;s:1:\"+\";i:6;s:1:\"E\";i:7;s:2:\"×\";i:8;s:3:\"‰\";i:9;s:3:\"∞\";i:10;s:3:\"NaN\";}s:12:\"currencyCode\";s:3:\"EUR\";s:14:\"currencySymbol\";s:3:\"€\";s:13:\"numberSymbols\";a:11:{i:0;s:1:\",\";i:1;s:1:\".\";i:2;s:1:\";\";i:3;s:1:\"%\";i:4;s:1:\"-\";i:5;s:1:\"+\";i:6;s:1:\"E\";i:7;s:2:\"×\";i:8;s:3:\"‰\";i:9;s:3:\"∞\";i:10;s:3:\"NaN\";}s:15:\"positivePattern\";s:12:\"#,##0.00 ¤\";s:15:\"negativePattern\";s:13:\"-#,##0.00 ¤\";s:17:\"maxFractionDigits\";i:2;s:17:\"minFractionDigits\";i:2;s:12:\"groupingUsed\";b:1;s:16:\"primaryGroupSize\";i:3;s:18:\"secondaryGroupSize\";i:3;}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:3;s:3:\"nbr\";i:557;s:5:\"value\";N;}i:1;a:7:{s:9:\"type_lite\";s:8:\"category\";s:4:\"type\";s:8:\"category\";s:6:\"id_key\";i:0;s:4:\"name\";s:11:\"Categorías\";s:6:\"values\";a:19:{i:19;a:2:{s:4:\"name\";s:6:\"BRONCE\";s:3:\"nbr\";s:1:\"5\";}i:46;a:3:{s:4:\"name\";s:9:\"TOBILLERA\";s:3:\"nbr\";s:2:\"13\";s:7:\"checked\";b:1;}i:47;a:2:{s:4:\"name\";s:26:\"JOYAS PERSONALIZADAS PLATA\";s:3:\"nbr\";s:2:\"16\";}i:48;a:2:{s:4:\"name\";s:19:\"COLECCIÓN INFANTIL\";s:3:\"nbr\";s:2:\"29\";}i:49;a:3:{s:4:\"name\";s:13:\"PULSERA PLATA\";s:3:\"nbr\";s:3:\"157\";s:7:\"checked\";b:1;}i:50;a:2:{s:4:\"name\";s:13:\"ANILLOS PLATA\";s:3:\"nbr\";s:3:\"188\";}i:51;a:3:{s:4:\"name\";s:16:\"PENDIENTES PLATA\";s:3:\"nbr\";s:3:\"356\";s:7:\"checked\";b:1;}i:52;a:3:{s:4:\"name\";s:4:\"AROS\";s:3:\"nbr\";s:1:\"6\";s:7:\"checked\";b:1;}i:53;a:3:{s:4:\"name\";s:8:\"PIERCING\";s:3:\"nbr\";s:2:\"25\";s:7:\"checked\";b:1;}i:55;a:2:{s:4:\"name\";s:17:\"GARGANTILLA PLATA\";s:3:\"nbr\";s:3:\"205\";}i:56;a:2:{s:4:\"name\";s:22:\"GARGANTILLAS INICIALES\";s:3:\"nbr\";s:1:\"4\";}i:57;a:2:{s:4:\"name\";s:6:\"CHOKER\";s:3:\"nbr\";s:1:\"1\";}i:61;a:2:{s:4:\"name\";s:8:\"EAR CUFF\";s:3:\"nbr\";s:1:\"5\";}i:63;a:2:{s:4:\"name\";s:18:\"LLAMADOR DE ÁNGEL\";s:3:\"nbr\";s:1:\"3\";}i:64;a:2:{s:4:\"name\";s:14:\"COLGANTE PLATA\";s:3:\"nbr\";s:2:\"15\";}i:66;a:2:{s:4:\"name\";s:24:\"DETALLES PARA PROFESORES\";s:3:\"nbr\";s:2:\"21\";}i:92;a:2:{s:4:\"name\";s:15:\"COLECCIÓN ané\";s:3:\"nbr\";s:1:\"5\";}i:94;a:2:{s:4:\"name\";s:9:\"TOBILLERA\";s:3:\"nbr\";s:1:\"4\";}i:105;a:2:{s:4:\"name\";s:7:\"ALIANZA\";s:3:\"nbr\";s:2:\"15\";}}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";s:1:\"0\";}}}")
11.043 ms 1 /modules/ps_facetedsearch/src/Filters/Block.php:209
803
SELECT SQL_NO_CACHE `id_guest`
FROM `prstshp_connections`
WHERE `id_guest` = 1392
AND `date_add` > '2026-04-13 12:34:00'
AND id_shop IN (1) 
ORDER BY `date_add` DESC LIMIT 1
10.660 ms 1 Yes /classes/Connection.php:168
73
SELECT SQL_NO_CACHE p.*, product_shop.*, stock.out_of_stock, IFNULL(stock.quantity, 0) AS quantity, IFNULL(product_attribute_shop.id_product_attribute, 0) AS id_product_attribute,
product_attribute_shop.minimal_quantity AS product_attribute_minimal_quantity, pl.`description`, pl.`description_short`, pl.`available_now`,
pl.`available_later`, pl.`link_rewrite`, pl.`meta_description`, pl.`meta_keywords`, pl.`meta_title`, pl.`name`, image_shop.`id_image` id_image,
il.`legend` as legend, m.`name` AS manufacturer_name, cl.`name` AS category_default,
DATEDIFF(product_shop.`date_add`, DATE_SUB("2026-04-13 00:00:00",
INTERVAL 30 DAY)) > 0 AS new, product_shop.price AS orderprice
FROM `prstshp_category_product` cp
LEFT JOIN `prstshp_product` p
ON p.`id_product` = cp.`id_product`
INNER JOIN prstshp_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1) LEFT JOIN `prstshp_product_attribute_shop` product_attribute_shop
ON (p.`id_product` = product_attribute_shop.`id_product` AND product_attribute_shop.`default_on` = 1 AND product_attribute_shop.id_shop=1)
LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `p`.id_product AND stock.id_product_attribute = 0 AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `prstshp_category_lang` cl
ON (product_shop.`id_category_default` = cl.`id_category`
AND cl.`id_lang` = 2 AND cl.id_shop = 1 )
LEFT JOIN `prstshp_product_lang` pl
ON (p.`id_product` = pl.`id_product`
AND pl.`id_lang` = 2 AND pl.id_shop = 1 )
LEFT JOIN `prstshp_image_shop` image_shop
ON (image_shop.`id_product` = p.`id_product` AND image_shop.cover=1 AND image_shop.id_shop=1)
LEFT JOIN `prstshp_image_lang` il
ON (image_shop.`id_image` = il.`id_image`
AND il.`id_lang` = 2)
LEFT JOIN `prstshp_manufacturer` m
ON m.`id_manufacturer` = p.`id_manufacturer`
WHERE product_shop.`id_shop` = 1
AND cp.`id_category` = 18 AND product_shop.`active` = 1 AND product_shop.`visibility` IN ("both", "catalog") ORDER BY cp.`position` ASC
LIMIT 288,24
6.536 ms 2349 /classes/Category.php:1062
704
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 2544
ORDER BY `position`
6.305 ms 1 Yes /classes/Product.php:3539
776
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2547) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
5.689 ms 1 Yes /classes/Product.php:4513
387
SELECT SQL_NO_CACHE psi.price_min, MIN(price_min) as min, MAX(price_max) as max FROM prstshp_product p INNER JOIN prstshp_layered_price_index psi ON (psi.id_product = p.id_product AND psi.id_shop = 1 AND psi.id_currency = 2 AND psi.id_country = 6) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND cp.id_category IN (52, 51, 53, 49, 46)
5.346 ms 1327 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
703
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (3098) AND il.`id_lang` = 2 ORDER by i.`position`
4.211 ms 1 Yes /classes/Product.php:2915
710
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 2542
ORDER BY `position`
3.838 ms 1 Yes /classes/Product.php:3539
766
SELECT SQL_NO_CACHE SUM(`quantity`)
FROM `prstshp_cart_product`
WHERE `id_cart` = 0 LIMIT 1
3.497 ms 1 /classes/Cart.php:1300
2
SELECT SQL_NO_CACHE c.`name`, cl.`id_lang`, IF(cl.`id_lang` IS NULL, c.`value`, cl.`value`) AS value, c.id_shop_group, c.id_shop
FROM `prstshp_configuration` c
LEFT JOIN `prstshp_configuration_lang` cl ON (c.`id_configuration` = cl.`id_configuration`)
3.217 ms 1360 /classes/Configuration.php:180
743
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 2520
ORDER BY `position`
2.950 ms 1 Yes /classes/Product.php:3539
88
SELECT SQL_NO_CACHE h.id_hook, h.name as h_name, title, description, h.position, hm.position as hm_position, m.id_module, m.name, m.active
FROM `prstshp_hook_module` hm
STRAIGHT_JOIN `prstshp_hook` h ON (h.id_hook = hm.id_hook AND hm.id_shop = 1)
STRAIGHT_JOIN `prstshp_module` as m ON (m.id_module = hm.id_module)
ORDER BY hm.position
1.867 ms 516 /classes/Hook.php:455
87
SELECT SQL_NO_CACHE `id_hook`, `name`
FROM `prstshp_hook`
UNION
SELECT `id_hook`, ha.`alias` as name
FROM `prstshp_hook_alias` ha
INNER JOIN `prstshp_hook` h ON ha.name = h.name
1.614 ms 0 /classes/Hook.php:1348
13
SELECT SQL_NO_CACHE h.`name` as hook, m.`id_module`, h.`id_hook`, m.`name` as module
FROM `prstshp_module` m
INNER JOIN prstshp_module_shop module_shop
ON (module_shop.id_module = m.id_module AND module_shop.id_shop = 1 AND module_shop.enable_device & 1)
INNER JOIN `prstshp_hook_module` `hm` ON hm.`id_module` = m.`id_module`
INNER JOIN `prstshp_hook` `h` ON hm.`id_hook` = h.`id_hook`
LEFT JOIN `prstshp_module_group` `mg` ON mg.`id_module` = m.`id_module`
WHERE (h.`name` != "paymentOptions") AND (hm.`id_shop` = 1) AND (mg.id_shop = 1 AND  mg.`id_group` IN (1))
GROUP BY hm.id_hook, hm.id_module
ORDER BY hm.`position`
1.479 ms 114 Yes Yes /classes/Hook.php:1289
391
SELECT SQL_NO_CACHE p.*,
ps.*,
pl.*,
sa.out_of_stock,
IFNULL(sa.quantity, 0) as quantity,
(DATEDIFF(
p.`date_add`,
DATE_SUB(
'2026-04-13 00:00:00',
INTERVAL 30 DAY
)
) > 0) as new
FROM prstshp_product p
LEFT JOIN prstshp_product_lang pl
ON pl.id_product = p.id_product
AND pl.id_shop = 1
AND pl.id_lang = 2
LEFT JOIN prstshp_stock_available sa   ON sa.id_product = p.id_product
AND sa.id_product_attribute = 0
AND sa.id_shop = 1 LEFT JOIN prstshp_product_shop ps
ON ps.id_product = p.id_product
AND ps.id_shop = 1
WHERE p.id_product IN (2556,2555,2554,2551,2549,2547,2545,2544,2543,2542,2541,2538,2535,2533,2532,2530,2528,2526,2525,2521,2520,2518,2517,2516)
1.373 ms 24 /classes/ProductAssembler.php:95
774
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2551) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
1.346 ms 1 Yes /classes/Product.php:4513
804
INSERT INTO `prstshp_connections_source` (`id_connections`, `http_referer`, `request_uri`, `keywords`, `date_add`) VALUES ('1392', '', 'www.joieriaorfi.es/18-joyas-de-plata?page=13&q=Categor%C3%ADas-AROS-PENDIENTES+PLATA-PIERCING-PULSERA+PLATA-TOBILLERA-CHOKER&resultsPerPage=24', '', '2026-04-13 13:04:17')
1.221 ms 1 /classes/ObjectModel.php:622
377
SELECT SQL_NO_CACHE `id_category`
FROM `prstshp_category_shop`
WHERE `id_category` = 18
AND `id_shop` = 1 LIMIT 1
1.208 ms 1 /classes/Category.php:2446
12
SELECT SQL_NO_CACHE lower(name) as name
FROM `prstshp_hook` h
WHERE (h.active = 1)
1.198 ms 1097 /classes/Hook.php:1388
757
SELECT SQL_NO_CACHE 1 FROM `prstshp_cart_rule` WHERE ((date_to >= "2026-04-13 00:00:00" AND date_to <= "2026-04-13 23:59:59") OR (date_from >= "2026-04-13 00:00:00" AND date_from <= "2026-04-13 23:59:59") OR (date_from < "2026-04-13 00:00:00" AND date_to > "2026-04-13 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
1.175 ms 7 /classes/CartRule.php:357
69
SELECT SQL_NO_CACHE value FROM `prstshp_configuration` WHERE `name` = "PS_MULTISHOP_FEATURE_ACTIVE" LIMIT 1
1.154 ms 1 /modules/ps_accounts/src/Adapter/Configuration.php:278
769
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module` WHERE `name` = "iqitproductsnav" LIMIT 1
1.054 ms 1 /classes/module/Module.php:2664
692
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 2551
ORDER BY `position`
1.004 ms 1 Yes /classes/Product.php:3539
16
SELECT SQL_NO_CACHE `id_hook`, `name` FROM `prstshp_hook`
0.922 ms 1097 /classes/Hook.php:1348
777
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2545) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.881 ms 1 Yes /classes/Product.php:4513
752
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 2516
ORDER BY `position`
0.825 ms 1 Yes /classes/Product.php:3539
460
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 2547 AND id_shop=1 LIMIT 1
0.765 ms 1 /classes/Product.php:6884
737
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 2525
ORDER BY `position`
0.764 ms 1 Yes /classes/Product.php:3539
15
SELECT SQL_NO_CACHE m.page, ml.url_rewrite, ml.id_lang
FROM `prstshp_meta` m
LEFT JOIN `prstshp_meta_lang` ml ON (m.id_meta = ml.id_meta AND ml.id_shop = 1 )
ORDER BY LENGTH(ml.url_rewrite) DESC
0.733 ms 56 Yes /classes/Dispatcher.php:654
778
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2544) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.701 ms 1 Yes /classes/Product.php:4513
39
SELECT SQL_NO_CACHE c.*, cl.`id_lang`, cl.`name`, cl.`description`, cl.`additional_description`, cl.`link_rewrite`, cl.`meta_title`, cl.`meta_keywords`, cl.`meta_description`
FROM `prstshp_category` c
INNER JOIN prstshp_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `prstshp_category_lang` cl ON (c.`id_category` = cl.`id_category` AND `id_lang` = 2  AND cl.id_shop = 1 )
LEFT JOIN `prstshp_category_group` cg ON (cg.`id_category` = c.`id_category`)
WHERE `id_parent` = 18
AND `active` = 1
AND cg.`id_group` =1
GROUP BY c.`id_category`
ORDER BY `level_depth` ASC, category_shop.`position` ASC
0.689 ms 21 Yes Yes /classes/Category.php:916
785
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2532) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.641 ms 1 Yes /classes/Product.php:4513
771
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2556) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.603 ms 1 Yes /classes/Product.php:4513
759
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module` WHERE `name` = "iqitlinksmanager" LIMIT 1
0.581 ms 1 /classes/module/Module.php:2664
84
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1248 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.543 ms 1 Yes /classes/SpecificPrice.php:576
758
SELECT SQL_NO_CACHE 1 FROM `prstshp_cart_rule` WHERE ((date_to >= "2026-04-13 00:00:00" AND date_to <= "2026-04-13 23:59:59") OR (date_from >= "2026-04-13 00:00:00" AND date_from <= "2026-04-13 23:59:59") OR (date_from < "2026-04-13 00:00:00" AND date_to > "2026-04-13 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
0.541 ms 7 /classes/CartRule.php:357
248
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1350 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.540 ms 1 Yes /classes/SpecificPrice.php:576
388
SELECT SQL_NO_CACHE c.`id_category`, cl.`name`
FROM `prstshp_category` c
INNER JOIN prstshp_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `prstshp_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
WHERE 1  AND `id_lang` = 2
AND c.`active` = 1
ORDER BY c.nleft, c.position
0.536 ms 97 Yes /classes/Category.php:710
772
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2555) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.535 ms 1 Yes /classes/Product.php:4513
655
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2518 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2518 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.531 ms 0 /classes/Cart.php:1430
511
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2542 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2542 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.530 ms 0 /classes/Cart.php:1430
224
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1341 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.528 ms 1 Yes /classes/SpecificPrice.php:576
787
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2528) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.528 ms 1 Yes /classes/Product.php:4513
756
SELECT SQL_NO_CACHE 1 FROM prstshp_cart_product cp INNER JOIN prstshp_product p
ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps
ON (ps.id_shop = cp.id_shop AND ps.id_product = p.id_product) WHERE cp.id_cart=0 LIMIT 1
0.518 ms 1 /classes/Cart.php:4250
378
SELECT SQL_NO_CACHE type, id_value, filter_show_limit, filter_type FROM prstshp_layered_category
WHERE controller = 'category'
AND id_category = 18
AND id_shop = 1
GROUP BY `type`, id_value ORDER BY position ASC
0.517 ms 2 Yes Yes /modules/ps_facetedsearch/src/Filters/Provider.php:57
779
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2543) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.509 ms 1 Yes /classes/Product.php:4513
793
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2517) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.507 ms 1 Yes /classes/Product.php:4513
794
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2516) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.499 ms 1 Yes /classes/Product.php:4513
789
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2525) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.498 ms 1 Yes /classes/Product.php:4513
667
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2517 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2517 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.497 ms 0 /classes/Cart.php:1430
491
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2543) AND (b.`id_shop` = 1) LIMIT 1
0.495 ms 1 /src/Adapter/EntityMapper.php:71
410
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2555 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.493 ms 1 Yes /classes/SpecificPrice.php:576
784
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2533) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.492 ms 1 Yes /classes/Product.php:4513
783
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2535) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.491 ms 1 Yes /classes/Product.php:4513
398
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2556 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.490 ms 1 Yes /classes/SpecificPrice.php:576
452
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2549
ORDER BY f.position ASC
0.489 ms 1 Yes /classes/Product.php:6024
253
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1350 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1350 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.488 ms 0 /classes/Cart.php:1430
767
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module` WHERE `name` = "iqitmegamenu" LIMIT 1
0.487 ms 1 /classes/module/Module.php:2664
788
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2526) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.486 ms 1 Yes /classes/Product.php:4513
368
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1378 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.486 ms 1 Yes /classes/SpecificPrice.php:576
116
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1262 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.485 ms 1 Yes /classes/SpecificPrice.php:576
780
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2542) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.484 ms 1 Yes /classes/Product.php:4513
786
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2530) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.484 ms 1 Yes /classes/Product.php:4513
320
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1373 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.483 ms 1 Yes /classes/SpecificPrice.php:576
434
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2551 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.482 ms 1 Yes /classes/SpecificPrice.php:576
128
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1263 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.478 ms 1 Yes /classes/SpecificPrice.php:576
638
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2520 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.478 ms 1 Yes /classes/SpecificPrice.php:576
790
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2521) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.477 ms 1 Yes /classes/Product.php:4513
104
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1260 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.476 ms 1 Yes /classes/SpecificPrice.php:576
458
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2547 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.474 ms 1 Yes /classes/SpecificPrice.php:576
164
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1310 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.473 ms 1 Yes /classes/SpecificPrice.php:576
792
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2518) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.471 ms 1 Yes /classes/Product.php:4513
140
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1264 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.469 ms 1 Yes /classes/SpecificPrice.php:576
782
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2538) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.467 ms 1 Yes /classes/Product.php:4513
152
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1265 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.466 ms 1 Yes /classes/SpecificPrice.php:576
791
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2520) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.466 ms 1 Yes /classes/Product.php:4513
200
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1339 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.464 ms 1 Yes /classes/SpecificPrice.php:576
113
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1262) AND (b.`id_shop` = 1) LIMIT 1
0.463 ms 1 /src/Adapter/EntityMapper.php:71
781
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2541) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.461 ms 1 Yes /classes/Product.php:4513
96
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1248 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1248 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.460 ms 0 /classes/Cart.php:1430
176
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1313 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.457 ms 1 Yes /classes/SpecificPrice.php:576
157
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1265 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1265 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.457 ms 0 /classes/Cart.php:1430
133
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1263 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1263 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.456 ms 0 /classes/Cart.php:1430
446
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2549 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.455 ms 1 Yes /classes/SpecificPrice.php:576
422
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2554 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.453 ms 1 Yes /classes/SpecificPrice.php:576
145
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1264 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1264 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.452 ms 0 /classes/Cart.php:1430
236
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1343 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.450 ms 1 Yes /classes/SpecificPrice.php:576
518
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2541 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.446 ms 1 Yes /classes/SpecificPrice.php:576
212
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1340 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.444 ms 1 Yes /classes/SpecificPrice.php:576
662
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2517 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.443 ms 1 Yes /classes/SpecificPrice.php:576
650
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2518 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.440 ms 1 Yes /classes/SpecificPrice.php:576
229
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1341 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1341 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.437 ms 0 /classes/Cart.php:1430
773
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2554) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.437 ms 1 Yes /classes/Product.php:4513
403
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2556 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2556 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.437 ms 0 /classes/Cart.php:1430
775
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (2549) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.436 ms 1 Yes /classes/Product.php:4513
760
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module_shop` WHERE `id_module` = 77 AND `id_shop` = 1 LIMIT 1
0.435 ms 1 /classes/module/Module.php:2137
121
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1262 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1262 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.431 ms 0 /classes/Cart.php:1430
188
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1315 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.431 ms 1 Yes /classes/SpecificPrice.php:576
674
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2516 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.426 ms 1 Yes /classes/SpecificPrice.php:576
217
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1340 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1340 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.424 ms 0 /classes/Cart.php:1430
415
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2555 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2555 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.424 ms 0 /classes/Cart.php:1430
734
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 2526
ORDER BY `position`
0.424 ms 1 Yes /classes/Product.php:3539
439
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2551 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2551 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.423 ms 0 /classes/Cart.php:1430
512
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2542
ORDER BY f.position ASC
0.421 ms 1 Yes /classes/Product.php:6024
0
SELECT SQL_NO_CACHE s.id_shop, CONCAT(su.physical_uri, su.virtual_uri) AS uri, su.domain, su.main
FROM prstshp_shop_url su
LEFT JOIN prstshp_shop s ON (s.id_shop = su.id_shop)
WHERE (su.domain = 'www.joieriaorfi.es' OR su.domain_ssl = 'www.joieriaorfi.es')
AND s.active = 1
AND s.deleted = 0
ORDER BY LENGTH(CONCAT(su.physical_uri, su.virtual_uri)) DESC
0.413 ms 1 Yes /classes/shop/Shop.php:1364
109
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1260 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1260 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.410 ms 0 /classes/Cart.php:1430
181
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1313 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1313 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.410 ms 0 /classes/Cart.php:1430
193
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1315 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1315 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.410 ms 0 /classes/Cart.php:1430
726
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 2532
0.409 ms 1 /classes/Product.php:2899
329
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1374) AND (b.`id_shop` = 1) LIMIT 1
0.409 ms 1 /src/Adapter/EntityMapper.php:71
332
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1374 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.406 ms 1 Yes /classes/SpecificPrice.php:576
427
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2554 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2554 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.403 ms 0 /classes/Cart.php:1430
523
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2541 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2541 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.401 ms 0 /classes/Cart.php:1430
254
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1350
ORDER BY f.position ASC
0.401 ms 1 Yes /classes/Product.php:6024
451
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2549 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2549 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.400 ms 0 /classes/Cart.php:1430
169
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1310 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1310 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.398 ms 0 /classes/Cart.php:1430
325
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1373 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1373 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.394 ms 0 /classes/Cart.php:1430
679
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2516 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2516 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.393 ms 0 /classes/Cart.php:1430
205
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1339 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1339 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.390 ms 0 /classes/Cart.php:1430
542
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2535 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.390 ms 1 Yes /classes/SpecificPrice.php:576
475
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2545 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2545 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.389 ms 0 /classes/Cart.php:1430
149
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1265) AND (b.`id_shop` = 1) LIMIT 1
0.388 ms 1 /src/Adapter/EntityMapper.php:71
578
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2530 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.387 ms 1 Yes /classes/SpecificPrice.php:576
77
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1248) AND (b.`id_shop` = 1) LIMIT 1
0.387 ms 1 /src/Adapter/EntityMapper.php:71
681
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 2556
ORDER BY `position`
0.387 ms 1 Yes /classes/Product.php:3539
506
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2542 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.383 ms 1 Yes /classes/SpecificPrice.php:576
470
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2545 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.382 ms 1 Yes /classes/SpecificPrice.php:576
134
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1263
ORDER BY f.position ASC
0.379 ms 1 Yes /classes/Product.php:6024
482
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2544 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.379 ms 1 Yes /classes/SpecificPrice.php:576
218
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1340
ORDER BY f.position ASC
0.378 ms 1 Yes /classes/Product.php:6024
499
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2543 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2543 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.377 ms 0 /classes/Cart.php:1430
643
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2520 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2520 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.377 ms 0 /classes/Cart.php:1430
494
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2543 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.374 ms 1 Yes /classes/SpecificPrice.php:576
560
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2533
ORDER BY f.position ASC
0.369 ms 1 Yes /classes/Product.php:6024
463
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2547 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2547 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.368 ms 0 /classes/Cart.php:1430
344
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1375 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.365 ms 1 Yes /classes/SpecificPrice.php:576
530
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2538 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.365 ms 1 Yes /classes/SpecificPrice.php:576
620
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2525
ORDER BY f.position ASC
0.365 ms 1 Yes /classes/Product.php:6024
349
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1375 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1375 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.362 ms 0 /classes/Cart.php:1430
1
SELECT SQL_NO_CACHE gs.*, s.*, gs.name AS group_name, s.name AS shop_name, s.active, su.domain, su.domain_ssl, su.physical_uri, su.virtual_uri
FROM prstshp_shop_group gs
LEFT JOIN prstshp_shop s
ON s.id_shop_group = gs.id_shop_group
LEFT JOIN prstshp_shop_url su
ON s.id_shop = su.id_shop AND su.main = 1
WHERE s.deleted = 0
AND gs.deleted = 0
ORDER BY gs.name, s.name
0.361 ms 1 Yes /classes/shop/Shop.php:715
361
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1377 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1377 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.361 ms 0 /classes/Cart.php:1430
373
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1378 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1378 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.360 ms 0 /classes/Cart.php:1430
161
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1310) AND (b.`id_shop` = 1) LIMIT 1
0.359 ms 1 /src/Adapter/EntityMapper.php:71
122
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1262
ORDER BY f.position ASC
0.355 ms 1 Yes /classes/Product.php:6024
686
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 2555
ORDER BY `position`
0.353 ms 1 Yes /classes/Product.php:3539
356
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1377 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.352 ms 1 Yes /classes/SpecificPrice.php:576
101
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1260) AND (b.`id_shop` = 1) LIMIT 1
0.350 ms 1 /src/Adapter/EntityMapper.php:71
284
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1363 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.350 ms 1 Yes /classes/SpecificPrice.php:576
362
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1377
ORDER BY f.position ASC
0.349 ms 1 Yes /classes/Product.php:6024
404
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2556
ORDER BY f.position ASC
0.349 ms 1 Yes /classes/Product.php:6024
467
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2545) AND (b.`id_shop` = 1) LIMIT 1
0.349 ms 1 /src/Adapter/EntityMapper.php:71
535
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2538 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2538 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.344 ms 0 /classes/Cart.php:1430
607
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2526 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2526 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.343 ms 0 /classes/Cart.php:1430
602
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2526 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.342 ms 1 Yes /classes/SpecificPrice.php:576
631
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2521 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2521 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.342 ms 0 /classes/Cart.php:1430
125
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1263) AND (b.`id_shop` = 1) LIMIT 1
0.342 ms 1 /src/Adapter/EntityMapper.php:71
97
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1248
ORDER BY f.position ASC
0.340 ms 1 Yes /classes/Product.php:6024
487
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2544 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2544 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.340 ms 0 /classes/Cart.php:1430
281
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1363) AND (b.`id_shop` = 1) LIMIT 1
0.339 ms 1 /src/Adapter/EntityMapper.php:71
337
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1374 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1374 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.338 ms 0 /classes/Cart.php:1430
272
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1362 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.338 ms 1 Yes /classes/SpecificPrice.php:576
416
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2555
ORDER BY f.position ASC
0.337 ms 1 Yes /classes/Product.php:6024
296
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1364 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.336 ms 1 Yes /classes/SpecificPrice.php:576
185
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1315) AND (b.`id_shop` = 1) LIMIT 1
0.336 ms 1 /src/Adapter/EntityMapper.php:71
443
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2549) AND (b.`id_shop` = 1) LIMIT 1
0.334 ms 1 /src/Adapter/EntityMapper.php:71
89
SELECT SQL_NO_CACHE tr.*
FROM `prstshp_tax_rule` tr
JOIN `prstshp_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 6
AND tr.`id_tax_rules_group` = 53
AND tr.`id_state` IN (0, 362)
AND ('08720' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '08720')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.333 ms 2 /classes/tax/TaxRulesTaxManager.php:100
407
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2555) AND (b.`id_shop` = 1) LIMIT 1
0.333 ms 1 /src/Adapter/EntityMapper.php:71
221
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1341) AND (b.`id_shop` = 1) LIMIT 1
0.332 ms 1 /src/Adapter/EntityMapper.php:71
515
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2541) AND (b.`id_shop` = 1) LIMIT 1
0.332 ms 1 /src/Adapter/EntityMapper.php:71
289
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1363 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1363 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.332 ms 0 /classes/Cart.php:1430
566
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2532 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.332 ms 1 Yes /classes/SpecificPrice.php:576
197
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1339) AND (b.`id_shop` = 1) LIMIT 1
0.331 ms 1 /src/Adapter/EntityMapper.php:71
488
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2544
ORDER BY f.position ASC
0.331 ms 1 Yes /classes/Product.php:6024
137
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1264) AND (b.`id_shop` = 1) LIMIT 1
0.331 ms 1 /src/Adapter/EntityMapper.php:71
313
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1365 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1365 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.331 ms 0 /classes/Cart.php:1430
659
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2517) AND (b.`id_shop` = 1) LIMIT 1
0.331 ms 1 /src/Adapter/EntityMapper.php:71
146
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1264
ORDER BY f.position ASC
0.330 ms 1 Yes /classes/Product.php:6024
206
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1339
ORDER BY f.position ASC
0.330 ms 1 Yes /classes/Product.php:6024
695
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 2549
ORDER BY `position`
0.330 ms 1 Yes /classes/Product.php:3539
182
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1313
ORDER BY f.position ASC
0.329 ms 1 Yes /classes/Product.php:6024
626
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2521 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.329 ms 1 Yes /classes/SpecificPrice.php:576
590
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2528 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.327 ms 1 Yes /classes/SpecificPrice.php:576
245
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1350) AND (b.`id_shop` = 1) LIMIT 1
0.326 ms 1 /src/Adapter/EntityMapper.php:71
619
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2525 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2525 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.326 ms 0 /classes/Cart.php:1430
419
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2554) AND (b.`id_shop` = 1) LIMIT 1
0.325 ms 1 /src/Adapter/EntityMapper.php:71
431
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2551) AND (b.`id_shop` = 1) LIMIT 1
0.325 ms 1 /src/Adapter/EntityMapper.php:71
223
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1341
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.324 ms 1 /classes/SpecificPrice.php:256
733
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (3081) AND il.`id_lang` = 2 ORDER by i.`position`
0.324 ms 1 Yes /classes/Product.php:2915
394
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2556) AND (b.`id_shop` = 1) LIMIT 1
0.323 ms 1 /src/Adapter/EntityMapper.php:71
260
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1361 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.322 ms 1 Yes /classes/SpecificPrice.php:576
158
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1265
ORDER BY f.position ASC
0.320 ms 1 Yes /classes/Product.php:6024
230
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1341
ORDER BY f.position ASC
0.320 ms 1 Yes /classes/Product.php:6024
668
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2517
ORDER BY f.position ASC
0.320 ms 1 Yes /classes/Product.php:6024
647
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2518) AND (b.`id_shop` = 1) LIMIT 1
0.319 ms 1 /src/Adapter/EntityMapper.php:71
559
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2533 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2533 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.317 ms 0 /classes/Cart.php:1430
671
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2516) AND (b.`id_shop` = 1) LIMIT 1
0.317 ms 1 /src/Adapter/EntityMapper.php:71
440
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2551
ORDER BY f.position ASC
0.316 ms 1 Yes /classes/Product.php:6024
614
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2525 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.316 ms 1 Yes /classes/SpecificPrice.php:576
554
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2533 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.315 ms 1 Yes /classes/SpecificPrice.php:576
801
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module` WHERE `name` = "iqitcookielaw" LIMIT 1
0.315 ms 1 /classes/module/Module.php:2664
277
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1362 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1362 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.314 ms 0 /classes/Cart.php:1430
301
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1364 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1364 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.313 ms 0 /classes/Cart.php:1430
241
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1343 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1343 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.312 ms 0 /classes/Cart.php:1430
341
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1375) AND (b.`id_shop` = 1) LIMIT 1
0.312 ms 1 /src/Adapter/EntityMapper.php:71
547
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2535 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2535 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.311 ms 0 /classes/Cart.php:1430
173
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1313) AND (b.`id_shop` = 1) LIMIT 1
0.310 ms 1 /src/Adapter/EntityMapper.php:71
464
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2547
ORDER BY f.position ASC
0.308 ms 1 Yes /classes/Product.php:6024
583
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2530 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2530 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.306 ms 0 /classes/Cart.php:1430
656
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2518
ORDER BY f.position ASC
0.306 ms 1 Yes /classes/Product.php:6024
8
SELECT SQL_NO_CACHE *
FROM `prstshp_lang` a
LEFT JOIN `prstshp_lang_shop` `c` ON a.`id_lang` = c.`id_lang` AND c.`id_shop` = 1
WHERE (a.`id_lang` = 2) LIMIT 1
0.305 ms 1 /src/Adapter/EntityMapper.php:71
644
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2520
ORDER BY f.position ASC
0.305 ms 1 Yes /classes/Product.php:6024
194
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1315
ORDER BY f.position ASC
0.304 ms 1 Yes /classes/Product.php:6024
117
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1262)
0.303 ms 1 /classes/Product.php:3860
308
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1365 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.303 ms 1 Yes /classes/SpecificPrice.php:576
428
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2554
ORDER BY f.position ASC
0.303 ms 1 Yes /classes/Product.php:6024
265
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1361 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1361 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.301 ms 0 /classes/Cart.php:1430
110
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1260
ORDER BY f.position ASC
0.301 ms 1 Yes /classes/Product.php:6024
571
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2532 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2532 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.300 ms 0 /classes/Cart.php:1430
257
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1361) AND (b.`id_shop` = 1) LIMIT 1
0.300 ms 1 /src/Adapter/EntityMapper.php:71
595
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2528 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2528 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.300 ms 0 /classes/Cart.php:1430
455
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2547) AND (b.`id_shop` = 1) LIMIT 1
0.299 ms 1 /src/Adapter/EntityMapper.php:71
18
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `prstshp_module` m
LEFT JOIN `prstshp_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
0.296 ms 102 /classes/module/Module.php:341
98
SELECT SQL_NO_CACHE tr.*
FROM `prstshp_tax_rule` tr
JOIN `prstshp_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 6
AND tr.`id_tax_rules_group` = 53
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.296 ms 1 /classes/tax/TaxRulesTaxManager.php:100
170
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1310
ORDER BY f.position ASC
0.295 ms 1 Yes /classes/Product.php:6024
579
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2530)
0.294 ms 1 /classes/Product.php:3860
468
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 2545 LIMIT 1
0.293 ms 1 /classes/SpecificPrice.php:435
548
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2535
ORDER BY f.position ASC
0.290 ms 1 Yes /classes/Product.php:6024
290
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1363
ORDER BY f.position ASC
0.286 ms 1 Yes /classes/Product.php:6024
615
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2525)
0.286 ms 1 /classes/Product.php:3860
707
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 2543
ORDER BY `position`
0.285 ms 1 Yes /classes/Product.php:3539
365
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1378) AND (b.`id_shop` = 1) LIMIT 1
0.284 ms 1 /src/Adapter/EntityMapper.php:71
680
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2516
ORDER BY f.position ASC
0.284 ms 1 Yes /classes/Product.php:6024
353
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1377) AND (b.`id_shop` = 1) LIMIT 1
0.283 ms 1 /src/Adapter/EntityMapper.php:71
732
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 2528
0.281 ms 1 /classes/Product.php:2899
713
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 2541
ORDER BY `position`
0.277 ms 1 Yes /classes/Product.php:3539
350
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1375
ORDER BY f.position ASC
0.275 ms 1 Yes /classes/Product.php:6024
689
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 2554
ORDER BY `position`
0.274 ms 1 Yes /classes/Product.php:3539
551
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2533) AND (b.`id_shop` = 1) LIMIT 1
0.273 ms 1 /src/Adapter/EntityMapper.php:71
503
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2542) AND (b.`id_shop` = 1) LIMIT 1
0.272 ms 1 /src/Adapter/EntityMapper.php:71
476
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2545
ORDER BY f.position ASC
0.272 ms 1 Yes /classes/Product.php:6024
28
SELECT SQL_NO_CACHE c.id_currency
FROM `prstshp_currency` c
WHERE (iso_code = 'USD') LIMIT 1
0.270 ms 1 /classes/Currency.php:893
392
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2556
AND image_shop.`cover` = 1 LIMIT 1
0.269 ms 1 /classes/Product.php:3570
527
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2538) AND (b.`id_shop` = 1) LIMIT 1
0.269 ms 1 /src/Adapter/EntityMapper.php:71
233
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1343) AND (b.`id_shop` = 1) LIMIT 1
0.268 ms 1 /src/Adapter/EntityMapper.php:71
338
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1374
ORDER BY f.position ASC
0.268 ms 1 Yes /classes/Product.php:6024
500
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2543
ORDER BY f.position ASC
0.268 ms 1 Yes /classes/Product.php:6024
6
SELECT SQL_NO_CACHE *
FROM `prstshp_country` a
LEFT JOIN `prstshp_country_lang` `b` ON a.`id_country` = b.`id_country` AND b.`id_lang` = 2
LEFT JOIN `prstshp_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 6) LIMIT 1
0.267 ms 1 /src/Adapter/EntityMapper.php:71
11
SELECT SQL_NO_CACHE COUNT(DISTINCT l.id_lang) FROM `prstshp_lang` l
JOIN prstshp_lang_shop lang_shop ON (lang_shop.id_lang = l.id_lang AND lang_shop.id_shop = 1)
WHERE l.`active` = 1 LIMIT 1
0.267 ms 4 /classes/Language.php:1214
326
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1373
ORDER BY f.position ASC
0.266 ms 1 Yes /classes/Product.php:6024
623
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2521) AND (b.`id_shop` = 1) LIMIT 1
0.266 ms 1 /src/Adapter/EntityMapper.php:71
374
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1378
ORDER BY f.position ASC
0.266 ms 1 Yes /classes/Product.php:6024
479
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2544) AND (b.`id_shop` = 1) LIMIT 1
0.263 ms 1 /src/Adapter/EntityMapper.php:71
524
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2541
ORDER BY f.position ASC
0.262 ms 1 Yes /classes/Product.php:6024
719
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 2535
ORDER BY `position`
0.262 ms 1 Yes /classes/Product.php:3539
739
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (3078) AND il.`id_lang` = 2 ORDER by i.`position`
0.260 ms 1 Yes /classes/Product.php:2915
148
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.259 ms 1 /classes/Product.php:5670
209
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1340) AND (b.`id_shop` = 1) LIMIT 1
0.259 ms 1 /src/Adapter/EntityMapper.php:71
805
SELECT SQL_NO_CACHE m.* FROM `prstshp_module` m
0.259 ms 102 /classes/module/Module.php:1724
141
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1264)
0.258 ms 1 /classes/Product.php:3860
635
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2520) AND (b.`id_shop` = 1) LIMIT 1
0.258 ms 1 /src/Adapter/EntityMapper.php:71
74
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1248
AND image_shop.`cover` = 1 LIMIT 1
0.256 ms 2 /classes/Product.php:3570
269
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1362) AND (b.`id_shop` = 1) LIMIT 1
0.256 ms 1 /src/Adapter/EntityMapper.php:71
376
SELECT SQL_NO_CACHE `name`
FROM `prstshp_hook`
WHERE `id_hook` = 746 LIMIT 1
0.255 ms 1 /classes/Hook.php:244
465
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2545
AND image_shop.`cover` = 1 LIMIT 1
0.255 ms 1 /classes/Product.php:3570
725
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 2532
ORDER BY `position`
0.255 ms 1 Yes /classes/Product.php:3539
800
SELECT SQL_NO_CACHE psgdprl.message FROM `prstshp_psgdpr_consent` psgdpr
LEFT JOIN prstshp_psgdpr_consent_lang psgdprl ON (psgdpr.id_gdpr_consent = psgdprl.id_gdpr_consent)
WHERE psgdpr.id_module = 22 AND psgdprl.id_lang =2 LIMIT 1
0.254 ms 8 /modules/psgdpr/classes/GDPRConsent.php:108
375
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a0
LEFT JOIN `prstshp_category_lang` `a1` ON (a0.`id_category` = a1.`id_category`)
WHERE (a0.`nleft` < 103) AND (a0.`nright` > 152) AND (a1.`id_lang` = 2) AND (a1.`id_shop` = 1)
ORDER BY a0.`nleft` asc
0.253 ms 97 Yes /classes/PrestaShopCollection.php:383
471
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2545)
0.253 ms 1 /classes/Product.php:3860
225
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1341)
0.252 ms 1 /classes/Product.php:3860
278
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1362
ORDER BY f.position ASC
0.252 ms 1 Yes /classes/Product.php:6024
317
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1373) AND (b.`id_shop` = 1) LIMIT 1
0.252 ms 1 /src/Adapter/EntityMapper.php:71
539
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2535) AND (b.`id_shop` = 1) LIMIT 1
0.252 ms 1 /src/Adapter/EntityMapper.php:71
123
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1263
AND image_shop.`cover` = 1 LIMIT 1
0.251 ms 1 /classes/Product.php:3570
249
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1350)
0.251 ms 1 /classes/Product.php:3860
399
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2556)
0.251 ms 1 /classes/Product.php:3860
716
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 2538
ORDER BY `position`
0.251 ms 1 Yes /classes/Product.php:3539
105
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1260)
0.251 ms 1 /classes/Product.php:3860
293
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1364) AND (b.`id_shop` = 1) LIMIT 1
0.248 ms 1 /src/Adapter/EntityMapper.php:71
599
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2526) AND (b.`id_shop` = 1) LIMIT 1
0.248 ms 1 /src/Adapter/EntityMapper.php:71
129
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1263)
0.247 ms 1 /classes/Product.php:3860
266
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1361
ORDER BY f.position ASC
0.247 ms 1 Yes /classes/Product.php:6024
305
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1365) AND (b.`id_shop` = 1) LIMIT 1
0.247 ms 1 /src/Adapter/EntityMapper.php:71
314
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1365
ORDER BY f.position ASC
0.247 ms 1 Yes /classes/Product.php:6024
379
SELECT SQL_NO_CACHE c.*, cl.*
FROM `prstshp_category` c
LEFT JOIN `prstshp_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 2 AND cl.id_shop = 1 )
WHERE `name` = 'AROS'
AND c.`id_category` != 2
AND c.`id_parent` = 18 LIMIT 1
0.247 ms 3 /classes/Category.php:1492
675
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2516)
0.247 ms 1 /classes/Product.php:3860
722
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 2533
ORDER BY `position`
0.247 ms 1 Yes /classes/Product.php:3539
495
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2543)
0.246 ms 1 /classes/Product.php:3860
536
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2538
ORDER BY f.position ASC
0.246 ms 1 Yes /classes/Product.php:6024
453
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2547
AND image_shop.`cover` = 1 LIMIT 1
0.245 ms 1 /classes/Product.php:3570
728
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 2530
ORDER BY `position`
0.245 ms 1 Yes /classes/Product.php:3539
698
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 2547
ORDER BY `position`
0.245 ms 1 Yes /classes/Product.php:3539
65
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a0
LEFT JOIN `prstshp_category_lang` `a1` ON (a0.`id_category` = a1.`id_category`)
WHERE (a0.`nleft` < 103) AND (a0.`nright` > 152) AND (a1.`id_lang` = 2) AND (a1.`id_shop` = 1)
ORDER BY a0.`nleft` asc
0.244 ms 97 Yes /classes/PrestaShopCollection.php:383
189
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1315)
0.244 ms 1 /classes/Product.php:3860
242
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1343
ORDER BY f.position ASC
0.243 ms 1 Yes /classes/Product.php:6024
563
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2532) AND (b.`id_shop` = 1) LIMIT 1
0.242 ms 1 /src/Adapter/EntityMapper.php:71
632
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2521
ORDER BY f.position ASC
0.242 ms 1 Yes /classes/Product.php:6024
795
SELECT SQL_NO_CACHE * FROM prstshp_corewhatsapp WHERE core_status=1 AND FIND_IN_SET('2', `core_language`)  LIMIT 0,1
0.242 ms 1 /modules/corewhatsapp/corewhatsapp.php:169
231
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1343
AND image_shop.`cover` = 1 LIMIT 1
0.240 ms 2 /classes/Product.php:3570
79
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1248 LIMIT 1
0.240 ms 1 /classes/SpecificPrice.php:435
477
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2544
AND image_shop.`cover` = 1 LIMIT 1
0.238 ms 1 /classes/Product.php:3570
3
SELECT SQL_NO_CACHE *
FROM `prstshp_shop` a
WHERE (a.`id_shop` = 1) LIMIT 1
0.237 ms 1 /src/Adapter/EntityMapper.php:71
45
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 51) AND (b.`id_shop` = 1) LIMIT 1
0.237 ms 1 /src/Adapter/EntityMapper.php:71
575
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2530) AND (b.`id_shop` = 1) LIMIT 1
0.237 ms 1 /src/Adapter/EntityMapper.php:71
584
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2530
ORDER BY f.position ASC
0.237 ms 1 Yes /classes/Product.php:6024
572
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2532
ORDER BY f.position ASC
0.236 ms 1 Yes /classes/Product.php:6024
596
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2528
ORDER BY f.position ASC
0.236 ms 1 Yes /classes/Product.php:6024
447
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2549)
0.236 ms 1 /classes/Product.php:3860
99
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1260
AND image_shop.`cover` = 1 LIMIT 1
0.235 ms 1 /classes/Product.php:3570
587
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2528) AND (b.`id_shop` = 1) LIMIT 1
0.234 ms 1 /src/Adapter/EntityMapper.php:71
701
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 2545
ORDER BY `position`
0.233 ms 1 Yes /classes/Product.php:3539
94
SELECT SQL_NO_CACHE tr.*
FROM `prstshp_tax_rule` tr
JOIN `prstshp_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 6
AND tr.`id_tax_rules_group` = 0
AND tr.`id_state` IN (0, 362)
AND ('08720' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '08720')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.232 ms 0 /classes/tax/TaxRulesTaxManager.php:100
165
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1310)
0.232 ms 1 /classes/Product.php:3860
423
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2554)
0.232 ms 1 /classes/Product.php:3860
435
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2551)
0.232 ms 1 /classes/Product.php:3860
669
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2516
AND image_shop.`cover` = 1 LIMIT 1
0.231 ms 1 /classes/Product.php:3570
429
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2551
AND image_shop.`cover` = 1 LIMIT 1
0.230 ms 1 /classes/Product.php:3570
594
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 2528) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.230 ms 1 /classes/stock/StockAvailable.php:453
608
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2526
ORDER BY f.position ASC
0.230 ms 1 Yes /classes/Product.php:6024
651
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2518)
0.230 ms 1 /classes/Product.php:3860
369
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1378)
0.230 ms 1 /classes/Product.php:3860
135
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1264
AND image_shop.`cover` = 1 LIMIT 1
0.229 ms 1 /classes/Product.php:3570
201
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1339)
0.229 ms 1 /classes/Product.php:3860
255
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1361
AND image_shop.`cover` = 1 LIMIT 1
0.229 ms 1 /classes/Product.php:3570
321
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1373)
0.229 ms 1 /classes/Product.php:3860
454
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.228 ms 1 /classes/Product.php:5670
770
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module_shop` WHERE `id_module` = 80 AND `id_shop` = 1 LIMIT 1
0.228 ms 1 /classes/module/Module.php:2137
147
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1265
AND image_shop.`cover` = 1 LIMIT 1
0.227 ms 1 /classes/Product.php:3570
411
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2555)
0.226 ms 1 /classes/Product.php:3860
177
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1313)
0.225 ms 1 /classes/Product.php:3860
459
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2547)
0.225 ms 1 /classes/Product.php:3860
611
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2525) AND (b.`id_shop` = 1) LIMIT 1
0.225 ms 1 /src/Adapter/EntityMapper.php:71
683
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (3109) AND il.`id_lang` = 2 ORDER by i.`position`
0.224 ms 1 Yes /classes/Product.php:2915
213
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1340)
0.223 ms 1 /classes/Product.php:3860
731
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 2528
ORDER BY `position`
0.223 ms 1 Yes /classes/Product.php:3539
663
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2517)
0.222 ms 1 /classes/Product.php:3860
153
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1265)
0.221 ms 1 /classes/Product.php:3860
333
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1374)
0.221 ms 1 /classes/Product.php:3860
639
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2520)
0.221 ms 1 /classes/Product.php:3860
4
SELECT SQL_NO_CACHE su.physical_uri, su.virtual_uri, su.domain, su.domain_ssl
FROM prstshp_shop s
LEFT JOIN prstshp_shop_url su ON (s.id_shop = su.id_shop)
WHERE s.id_shop = 1
AND s.active = 1 AND s.deleted = 0 AND su.main = 1 LIMIT 1
0.220 ms 1 /classes/shop/Shop.php:214
405
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2555
AND image_shop.`cover` = 1 LIMIT 1
0.220 ms 1 /classes/Product.php:3570
309
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1365)
0.220 ms 1 /classes/Product.php:3860
302
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1364
ORDER BY f.position ASC
0.217 ms 1 Yes /classes/Product.php:6024
513
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2541
AND image_shop.`cover` = 1 LIMIT 1
0.217 ms 1 /classes/Product.php:3570
330
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1374 LIMIT 1
0.216 ms 1 /classes/SpecificPrice.php:435
207
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1340
AND image_shop.`cover` = 1 LIMIT 1
0.214 ms 1 /classes/Product.php:3570
80
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE `id_product` != 0 LIMIT 1
0.214 ms 1809 /classes/SpecificPrice.php:297
5
SELECT SQL_NO_CACHE l.*, ls.`id_shop`
FROM `prstshp_lang` l
LEFT JOIN `prstshp_lang_shop` ls ON (l.id_lang = ls.id_lang)
0.213 ms 2 /classes/Language.php:1080
519
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2541)
0.212 ms 1 /classes/Product.php:3860
246
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1350 LIMIT 1
0.211 ms 1 /classes/SpecificPrice.php:435
228
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1341) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.210 ms 1 /classes/stock/StockAvailable.php:453
273
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1362)
0.210 ms 1 /classes/Product.php:3860
417
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2554
AND image_shop.`cover` = 1 LIMIT 1
0.210 ms 1 /classes/Product.php:3570
507
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2542)
0.210 ms 1 /classes/Product.php:3860
531
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2538)
0.209 ms 1 /classes/Product.php:3860
540
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 2535 LIMIT 1
0.209 ms 1 /classes/SpecificPrice.php:435
549
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2533
AND image_shop.`cover` = 1 LIMIT 1
0.208 ms 1 /classes/Product.php:3570
691
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (3107) AND il.`id_lang` = 2 ORDER by i.`position`
0.207 ms 1 Yes /classes/Product.php:2915
657
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2517
AND image_shop.`cover` = 1 LIMIT 1
0.207 ms 1 /classes/Product.php:3570
327
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1374
AND image_shop.`cover` = 1 LIMIT 1
0.206 ms 2 /classes/Product.php:3570
483
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2544)
0.206 ms 1 /classes/Product.php:3860
746
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 2518
ORDER BY `position`
0.205 ms 1 Yes /classes/Product.php:3539
159
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1310
AND image_shop.`cover` = 1 LIMIT 1
0.204 ms 1 /classes/Product.php:3570
183
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1315
AND image_shop.`cover` = 1 LIMIT 1
0.204 ms 1 /classes/Product.php:3570
516
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 2541 LIMIT 1
0.204 ms 1 /classes/SpecificPrice.php:435
709
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (3096) AND il.`id_lang` = 2 ORDER by i.`position`
0.204 ms 1 Yes /classes/Product.php:2915
382
SELECT SQL_NO_CACHE c.*, cl.*
FROM `prstshp_category` c
LEFT JOIN `prstshp_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 2 AND cl.id_shop = 1 )
WHERE `name` = 'PULSERA PLATA'
AND c.`id_category` != 2
AND c.`id_parent` = 18 LIMIT 1
0.204 ms 3 /classes/Category.php:1492
718
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (3091) AND il.`id_lang` = 2 ORDER by i.`position`
0.204 ms 1 Yes /classes/Product.php:2915
20
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 18) AND (b.`id_shop` = 1) LIMIT 1
0.203 ms 1 /src/Adapter/EntityMapper.php:71
339
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1375
AND image_shop.`cover` = 1 LIMIT 1
0.203 ms 2 /classes/Product.php:3570
597
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2526
AND image_shop.`cover` = 1 LIMIT 1
0.201 ms 1 /classes/Product.php:3570
85
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1248)
0.200 ms 1 /classes/Product.php:3860
195
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1339
AND image_shop.`cover` = 1 LIMIT 1
0.200 ms 1 /classes/Product.php:3570
219
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1341
AND image_shop.`cover` = 1 LIMIT 1
0.200 ms 1 /classes/Product.php:3570
319
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1373
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.200 ms 1 /classes/SpecificPrice.php:256
441
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2549
AND image_shop.`cover` = 1 LIMIT 1
0.200 ms 1 /classes/Product.php:3570
706
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (3097) AND il.`id_lang` = 2 ORDER by i.`position`
0.200 ms 1 Yes /classes/Product.php:2915
688
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (3108) AND il.`id_lang` = 2 ORDER by i.`position`
0.199 ms 1 Yes /classes/Product.php:2915
727
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (3085) AND il.`id_lang` = 2 ORDER by i.`position`
0.199 ms 1 Yes /classes/Product.php:2915
380
SELECT SQL_NO_CACHE c.*, cl.*
FROM `prstshp_category` c
LEFT JOIN `prstshp_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 2 AND cl.id_shop = 1 )
WHERE `name` = 'PENDIENTES PLATA'
AND c.`id_category` != 2
AND c.`id_parent` = 18 LIMIT 1
0.198 ms 7 /classes/Category.php:1492
736
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (3079) AND il.`id_lang` = 2 ORDER by i.`position`
0.198 ms 1 Yes /classes/Product.php:2915
489
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2543
AND image_shop.`cover` = 1 LIMIT 1
0.197 ms 1 /classes/Product.php:3570
184
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.197 ms 1 /classes/Product.php:5670
697
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (3102) AND il.`id_lang` = 2 ORDER by i.`position`
0.196 ms 1 Yes /classes/Product.php:2915
291
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1364
AND image_shop.`cover` = 1 LIMIT 1
0.195 ms 3 /classes/Product.php:3570
56
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module` WHERE `name` = "ps_legalcompliance" LIMIT 1
0.194 ms 0 /classes/module/Module.php:2664
261
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1361)
0.193 ms 1 /classes/Product.php:3860
654
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 2518) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.193 ms 1 /classes/stock/StockAvailable.php:453
66
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module` WHERE `name` = "ps_facebook" LIMIT 1
0.192 ms 1 /classes/module/Module.php:2664
285
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1363)
0.192 ms 1 /classes/Product.php:3860
345
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1375)
0.192 ms 1 /classes/Product.php:3860
694
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (3104) AND il.`id_lang` = 2 ORDER by i.`position`
0.192 ms 1 Yes /classes/Product.php:2915
749
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 2517
ORDER BY `position`
0.192 ms 1 Yes /classes/Product.php:3539
501
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2542
AND image_shop.`cover` = 1 LIMIT 1
0.191 ms 1 /classes/Product.php:3570
381
SELECT SQL_NO_CACHE c.*, cl.*
FROM `prstshp_category` c
LEFT JOIN `prstshp_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 2 AND cl.id_shop = 1 )
WHERE `name` = 'PIERCING'
AND c.`id_category` != 2
AND c.`id_parent` = 18 LIMIT 1
0.191 ms 4 /classes/Category.php:1492
383
SELECT SQL_NO_CACHE c.*, cl.*
FROM `prstshp_category` c
LEFT JOIN `prstshp_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 2 AND cl.id_shop = 1 )
WHERE `name` = 'TOBILLERA'
AND c.`id_category` != 2
AND c.`id_parent` = 18 LIMIT 1
0.191 ms 8 /classes/Category.php:1492
29
SELECT SQL_NO_CACHE *
FROM `prstshp_currency` a
LEFT JOIN `prstshp_currency_lang` `b` ON a.`id_currency` = b.`id_currency` AND b.`id_lang` = 2
LEFT JOIN `prstshp_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
0.190 ms 1 /src/Adapter/EntityMapper.php:71
318
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1373 LIMIT 1
0.190 ms 1 /classes/SpecificPrice.php:435
384
SELECT SQL_NO_CACHE c.*, cl.*
FROM `prstshp_category` c
LEFT JOIN `prstshp_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 2 AND cl.id_shop = 1 )
WHERE `name` = 'CHOKER'
AND c.`id_category` != 2
AND c.`id_parent` = 18 LIMIT 1
0.190 ms 5 /classes/Category.php:1492
724
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (3086) AND il.`id_lang` = 2 ORDER by i.`position`
0.190 ms 1 Yes /classes/Product.php:2915
357
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1377)
0.189 ms 1 /classes/Product.php:3860
721
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (3088) AND il.`id_lang` = 2 ORDER by i.`position`
0.189 ms 1 Yes /classes/Product.php:2915
502
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.188 ms 1 /classes/Product.php:5670
34
SELECT SQL_NO_CACHE *
FROM `prstshp_group` a
LEFT JOIN `prstshp_group_shop` `c` ON a.`id_group` = c.`id_group` AND c.`id_shop` = 1
WHERE (a.`id_group` = 1) LIMIT 1
0.188 ms 1 /src/Adapter/EntityMapper.php:71
366
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1378 LIMIT 1
0.187 ms 1 /classes/SpecificPrice.php:435
525
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2538
AND image_shop.`cover` = 1 LIMIT 1
0.187 ms 1 /classes/Product.php:3570
591
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2528)
0.187 ms 1 /classes/Product.php:3860
645
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2518
AND image_shop.`cover` = 1 LIMIT 1
0.187 ms 1 /classes/Product.php:3570
700
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (3100) AND il.`id_lang` = 2 ORDER by i.`position`
0.186 ms 1 Yes /classes/Product.php:2915
111
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1262
AND image_shop.`cover` = 1 LIMIT 1
0.185 ms 1 /classes/Product.php:3570
237
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1343)
0.185 ms 1 /classes/Product.php:3860
712
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (3095) AND il.`id_lang` = 2 ORDER by i.`position`
0.185 ms 1 Yes /classes/Product.php:2915
70
SELECT SQL_NO_CACHE `id_configuration`
FROM `prstshp_configuration`
WHERE name = 'PS_ACCOUNTS_SHOP_STATUS'
AND (id_shop_group IS NULL OR id_shop_group = 0) AND (id_shop IS NULL OR id_shop = 0) LIMIT 1
0.184 ms 1 /classes/Configuration.php:133
288
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1363) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.184 ms 1 /classes/stock/StockAvailable.php:453
10
SELECT SQL_NO_CACHE domain, domain_ssl
FROM prstshp_shop_url
WHERE main = 1
AND id_shop = 1 LIMIT 1
0.184 ms 1 /classes/shop/ShopUrl.php:178
715
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (3094) AND il.`id_lang` = 2 ORDER by i.`position`
0.184 ms 1 Yes /classes/Product.php:2915
395
SELECT SQL_NO_CACHE `name`
FROM `prstshp_manufacturer`
WHERE `id_manufacturer` = 17
AND `active` = 1 LIMIT 1
0.183 ms 0 /classes/Manufacturer.php:312
543
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2535)
0.181 ms 1 /classes/Product.php:3860
103
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1260
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.181 ms 0 /classes/SpecificPrice.php:256
546
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 2535) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.181 ms 1 /classes/stock/StockAvailable.php:453
351
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1377
AND image_shop.`cover` = 1 LIMIT 1
0.180 ms 1 /classes/Product.php:3570
567
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2532)
0.178 ms 1 /classes/Product.php:3860
648
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 2518 LIMIT 1
0.178 ms 1 /classes/SpecificPrice.php:435
280
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.177 ms 1 /classes/Product.php:5670
573
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2530
AND image_shop.`cover` = 1 LIMIT 1
0.177 ms 1 /classes/Product.php:3570
102
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1260 LIMIT 1
0.176 ms 1 /classes/SpecificPrice.php:435
363
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1378
AND image_shop.`cover` = 1 LIMIT 1
0.176 ms 1 /classes/Product.php:3570
510
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 2542) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.176 ms 1 /classes/stock/StockAvailable.php:453
561
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2532
AND image_shop.`cover` = 1 LIMIT 1
0.176 ms 1 /classes/Product.php:3570
243
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1350
AND image_shop.`cover` = 1 LIMIT 1
0.175 ms 1 /classes/Product.php:3570
555
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2533)
0.175 ms 1 /classes/Product.php:3860
621
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2521
AND image_shop.`cover` = 1 LIMIT 1
0.175 ms 1 /classes/Product.php:3570
627
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2521)
0.175 ms 1 /classes/Product.php:3860
687
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 2555
0.173 ms 1 /classes/Product.php:2899
150
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1265 LIMIT 1
0.172 ms 1 /classes/SpecificPrice.php:435
730
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (3083) AND il.`id_lang` = 2 ORDER by i.`position`
0.172 ms 1 Yes /classes/Product.php:2915
312
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1365) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.171 ms 1 /classes/stock/StockAvailable.php:453
274
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1362 AND id_shop=1 LIMIT 1
0.169 ms 1 /classes/Product.php:6884
297
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1364)
0.169 ms 1 /classes/Product.php:3860
473
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 2545 AND `id_group` = 1 LIMIT 1
0.169 ms 0 /classes/GroupReduction.php:153
636
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 2520 LIMIT 1
0.169 ms 1 /classes/SpecificPrice.php:435
81
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE `from` BETWEEN '2026-04-13 00:00:00' AND '2026-04-13 23:59:59' LIMIT 1
0.167 ms 1 /classes/SpecificPrice.php:377
58
SELECT SQL_NO_CACHE * FROM `prstshp_image_type` WHERE 1 AND `products` = 1  ORDER BY `width` DESC, `height` DESC, `name`ASC
0.167 ms 8 Yes /classes/ImageType.php:109
95
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1248) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.166 ms 1 /classes/stock/StockAvailable.php:453
402
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 2556) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.166 ms 1 /classes/stock/StockAvailable.php:453
504
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 2542 LIMIT 1
0.166 ms 1 /classes/SpecificPrice.php:435
603
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2526)
0.166 ms 1 /classes/Product.php:3860
742
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (3074) AND il.`id_lang` = 2 ORDER by i.`position`
0.166 ms 1 Yes /classes/Product.php:2915
59
SELECT SQL_NO_CACHE format
FROM `prstshp_address_format`
WHERE `id_country` = 6 LIMIT 1
0.164 ms 1 /classes/AddressFormat.php:653
171
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1313
AND image_shop.`cover` = 1 LIMIT 1
0.164 ms 1 /classes/Product.php:3570
279
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1363
AND image_shop.`cover` = 1 LIMIT 1
0.164 ms 1 /classes/Product.php:3570
537
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2535
AND image_shop.`cover` = 1 LIMIT 1
0.164 ms 1 /classes/Product.php:3570
21
SELECT SQL_NO_CACHE * FROM `prstshp_currency` c ORDER BY `iso_code` ASC
0.163 ms 2 Yes /classes/Currency.php:708
474
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 2545) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.163 ms 1 /classes/stock/StockAvailable.php:453
78
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 0 LIMIT 1
0.163 ms 1 /classes/SpecificPrice.php:426
203
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1339 AND `id_group` = 1 LIMIT 1
0.163 ms 0 /classes/GroupReduction.php:153
492
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 2543 LIMIT 1
0.162 ms 1 /classes/SpecificPrice.php:435
267
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1362
AND image_shop.`cover` = 1 LIMIT 1
0.160 ms 1 /classes/Product.php:3570
114
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1262 LIMIT 1
0.160 ms 1 /classes/SpecificPrice.php:435
192
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1315) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.160 ms 1 /classes/stock/StockAvailable.php:453
354
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1377 LIMIT 1
0.160 ms 1 /classes/SpecificPrice.php:435
120
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1262) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.159 ms 1 /classes/stock/StockAvailable.php:453
609
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2525
AND image_shop.`cover` = 1 LIMIT 1
0.158 ms 1 /classes/Product.php:3570
585
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2528
AND image_shop.`cover` = 1 LIMIT 1
0.157 ms 1 /classes/Product.php:3570
723
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 2533
0.157 ms 1 /classes/Product.php:2899
745
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (3073) AND il.`id_lang` = 2 ORDER by i.`position`
0.156 ms 1 Yes /classes/Product.php:2915
31
SELECT SQL_NO_CACHE *
FROM `prstshp_currency` a
LEFT JOIN `prstshp_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 2) LIMIT 1
0.156 ms 1 /src/Adapter/EntityMapper.php:71
444
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 2549 LIMIT 1
0.155 ms 1 /classes/SpecificPrice.php:435
768
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module_shop` WHERE `id_module` = 78 AND `id_shop` = 1 LIMIT 1
0.155 ms 1 /classes/module/Module.php:2137
14
SELECT SQL_NO_CACHE `name`, `alias` FROM `prstshp_hook_alias`
0.154 ms 88 /classes/Hook.php:290
126
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1263 LIMIT 1
0.154 ms 1 /classes/SpecificPrice.php:435
633
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2520
AND image_shop.`cover` = 1 LIMIT 1
0.154 ms 1 /classes/Product.php:3570
40
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 46) AND (b.`id_shop` = 1) LIMIT 1
0.154 ms 1 /src/Adapter/EntityMapper.php:71
76
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.153 ms 1 /classes/Product.php:5670
156
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1265) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.153 ms 1 /classes/stock/StockAvailable.php:453
251
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1350 AND `id_group` = 1 LIMIT 1
0.153 ms 0 /classes/GroupReduction.php:153
315
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1373
AND image_shop.`cover` = 1 LIMIT 1
0.153 ms 2 /classes/Product.php:3570
162
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1310 LIMIT 1
0.153 ms 1 /classes/SpecificPrice.php:435
204
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1339) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.153 ms 1 /classes/stock/StockAvailable.php:453
25
SELECT SQL_NO_CACHE *
FROM `prstshp_currency` a
LEFT JOIN `prstshp_currency_lang` `b` ON a.`id_currency` = b.`id_currency` AND b.`id_lang` = 2
LEFT JOIN `prstshp_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 2) LIMIT 1
0.152 ms 1 /src/Adapter/EntityMapper.php:71
91
SELECT SQL_NO_CACHE *
FROM `prstshp_tax_lang`
WHERE `id_tax` = 53
0.152 ms 2 /src/Adapter/EntityMapper.php:79
144
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1264) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.152 ms 1 /classes/stock/StockAvailable.php:453
558
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 2533) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.152 ms 1 /classes/stock/StockAvailable.php:453
138
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1264 LIMIT 1
0.152 ms 1 /classes/SpecificPrice.php:435
71
SELECT SQL_NO_CACHE *
FROM `prstshp_configuration` a
WHERE (a.`id_configuration` = 1315) LIMIT 1
0.151 ms 1 /src/Adapter/EntityMapper.php:71
408
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 2555 LIMIT 1
0.151 ms 1 /classes/SpecificPrice.php:435
168
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1310) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.151 ms 1 /classes/stock/StockAvailable.php:453
222
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1341 LIMIT 1
0.151 ms 1 /classes/SpecificPrice.php:435
303
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1365
AND image_shop.`cover` = 1 LIMIT 1
0.151 ms 1 /classes/Product.php:3570
462
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 2547) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.151 ms 1 /classes/stock/StockAvailable.php:453
108
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1260) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.150 ms 1 /classes/stock/StockAvailable.php:453
486
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 2544) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.150 ms 1 /classes/stock/StockAvailable.php:453
754
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (3069) AND il.`id_lang` = 2 ORDER by i.`position`
0.150 ms 1 Yes /classes/Product.php:2915
198
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1339 LIMIT 1
0.149 ms 1 /classes/SpecificPrice.php:435
324
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1373) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.149 ms 1 /classes/stock/StockAvailable.php:453
592
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 2528 AND id_shop=1 LIMIT 1
0.149 ms 1 /classes/Product.php:6884
748
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (3071) AND il.`id_lang` = 2 ORDER by i.`position`
0.149 ms 1 Yes /classes/Product.php:2915
124
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.148 ms 1 /classes/Product.php:5670
396
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 2556 LIMIT 1
0.148 ms 1 /classes/SpecificPrice.php:435
660
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 2517 LIMIT 1
0.147 ms 1 /classes/SpecificPrice.php:435
461
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 2547 AND `id_group` = 1 LIMIT 1
0.147 ms 0 /classes/GroupReduction.php:153
466
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.147 ms 1 /classes/Product.php:5670
210
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1340 LIMIT 1
0.146 ms 1 /classes/SpecificPrice.php:435
666
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 2517) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.146 ms 1 /classes/stock/StockAvailable.php:453
174
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1313 LIMIT 1
0.145 ms 1 /classes/SpecificPrice.php:435
386
SELECT SQL_NO_CACHE data FROM prstshp_layered_filter_block WHERE hash="938355e22b17137bcfe731b203709892" LIMIT 1
0.145 ms 1 /modules/ps_facetedsearch/src/Filters/Block.php:185
705
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 2544
0.145 ms 1 /classes/Product.php:2899
751
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (3070) AND il.`id_lang` = 2 ORDER by i.`position`
0.145 ms 1 Yes /classes/Product.php:2915
54
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 92) AND (b.`id_shop` = 1) LIMIT 1
0.144 ms 1 /src/Adapter/EntityMapper.php:71
61
SELECT SQL_NO_CACHE *
FROM `prstshp_country` a
LEFT JOIN `prstshp_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 6) LIMIT 1
0.143 ms 1 /src/Adapter/EntityMapper.php:71
180
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1313) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.143 ms 1 /classes/stock/StockAvailable.php:453
420
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 2554 LIMIT 1
0.143 ms 1 /classes/SpecificPrice.php:435
276
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1362) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.143 ms 1 /classes/stock/StockAvailable.php:453
450
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 2549) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.143 ms 1 /classes/stock/StockAvailable.php:453
696
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 2549
0.142 ms 1 /classes/Product.php:2899
9
SELECT SQL_NO_CACHE id_shop
FROM `prstshp_lang_shop`
WHERE `id_lang` = 2
AND id_shop = 1 LIMIT 1
0.142 ms 1 /classes/ObjectModel.php:1727
100
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.142 ms 1 /classes/Product.php:5670
46
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 52) AND (b.`id_shop` = 1) LIMIT 1
0.141 ms 1 /src/Adapter/EntityMapper.php:71
186
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1315 LIMIT 1
0.141 ms 1 /classes/SpecificPrice.php:435
348
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1375) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.141 ms 1 /classes/stock/StockAvailable.php:453
622
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.141 ms 1 /classes/Product.php:5670
50
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 56) AND (b.`id_shop` = 1) LIMIT 1
0.140 ms 1 /src/Adapter/EntityMapper.php:71
741
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 2521
0.140 ms 1 /classes/Product.php:2899
41
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 48) AND (b.`id_shop` = 1) LIMIT 1
0.140 ms 1 /src/Adapter/EntityMapper.php:71
42
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 47) AND (b.`id_shop` = 1) LIMIT 1
0.140 ms 1 /src/Adapter/EntityMapper.php:71
90
SELECT SQL_NO_CACHE *
FROM `prstshp_tax` a
WHERE (a.`id_tax` = 53) LIMIT 1
0.140 ms 1 /src/Adapter/EntityMapper.php:71
247
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1350
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.140 ms 0 /classes/SpecificPrice.php:256
457
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 2547
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.140 ms 0 /classes/SpecificPrice.php:256
522
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 2541) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.140 ms 1 /classes/stock/StockAvailable.php:453
7
SELECT SQL_NO_CACHE *
FROM `prstshp_shop_group` a
WHERE (a.`id_shop_group` = 1) LIMIT 1
0.139 ms 1 /src/Adapter/EntityMapper.php:71
412
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 2555 AND id_shop=1 LIMIT 1
0.139 ms 1 /classes/Product.php:6884
414
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 2555) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.139 ms 1 /classes/stock/StockAvailable.php:453
426
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 2554) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.139 ms 1 /classes/stock/StockAvailable.php:453
432
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 2551 LIMIT 1
0.139 ms 1 /classes/SpecificPrice.php:435
685
SELECT SQL_NO_CACHE * FROM `prstshp_image_type`
0.139 ms 8 /classes/ImageType.php:161
47
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 53) AND (b.`id_shop` = 1) LIMIT 1
0.138 ms 1 /src/Adapter/EntityMapper.php:71
216
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1340) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.138 ms 1 /classes/stock/StockAvailable.php:453
528
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 2538 LIMIT 1
0.138 ms 1 /classes/SpecificPrice.php:435
682
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 2556
0.138 ms 1 /classes/Product.php:2899
49
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 66) AND (b.`id_shop` = 1) LIMIT 1
0.138 ms 1 /src/Adapter/EntityMapper.php:71
517
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 2541
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.137 ms 0 /classes/SpecificPrice.php:256
690
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 2554
0.137 ms 1 /classes/Product.php:2899
372
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1378) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.137 ms 1 /classes/stock/StockAvailable.php:453
456
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 2547 LIMIT 1
0.137 ms 1 /classes/SpecificPrice.php:435
19
SELECT SQL_NO_CACHE name, alias FROM `prstshp_hook_alias`
0.136 ms 88 /classes/Hook.php:342
43
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 49) AND (b.`id_shop` = 1) LIMIT 1
0.136 ms 1 /src/Adapter/EntityMapper.php:71
86
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1248 AND id_shop=1 LIMIT 1
0.136 ms 1 /classes/Product.php:6884
637
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 2520
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.136 ms 0 /classes/SpecificPrice.php:256
678
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 2516) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.136 ms 1 /classes/stock/StockAvailable.php:453
684
SELECT SQL_NO_CACHE state FROM prstshp_feature_flag WHERE name = 'multiple_image_format' LIMIT 1
0.136 ms 1 /classes/FeatureFlag.php:105
711
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 2542
0.136 ms 1 /classes/Product.php:2899
55
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 105) AND (b.`id_shop` = 1) LIMIT 1
0.135 ms 1 /src/Adapter/EntityMapper.php:71
83
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1248
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.135 ms 1 /classes/SpecificPrice.php:256
136
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.135 ms 1 /classes/Product.php:5670
672
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 2516 LIMIT 1
0.135 ms 1 /classes/SpecificPrice.php:435
92
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1248 AND `id_group` = 1 LIMIT 1
0.134 ms 0 /classes/GroupReduction.php:153
406
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.134 ms 1 /classes/Product.php:5670
480
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 2544 LIMIT 1
0.134 ms 1 /classes/SpecificPrice.php:435
714
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 2541
0.134 ms 1 /classes/Product.php:2899
112
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.133 ms 1 /classes/Product.php:5670
360
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1377) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.133 ms 1 /classes/stock/StockAvailable.php:453
438
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 2551) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.133 ms 1 /classes/stock/StockAvailable.php:453
534
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 2538) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.132 ms 1 /classes/stock/StockAvailable.php:453
738
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 2525
0.132 ms 1 /classes/Product.php:2899
702
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 2545
0.131 ms 1 /classes/Product.php:2899
258
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1361 LIMIT 1
0.131 ms 1 /classes/SpecificPrice.php:435
498
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 2543) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.131 ms 1 /classes/stock/StockAvailable.php:453
799
SELECT SQL_NO_CACHE psgdpr.active FROM `prstshp_psgdpr_consent` psgdpr
WHERE psgdpr.id_module = 22 LIMIT 1
0.131 ms 8 /modules/psgdpr/classes/GDPRConsent.php:130
44
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 50) AND (b.`id_shop` = 1) LIMIT 1
0.130 ms 1 /src/Adapter/EntityMapper.php:71
48
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 55) AND (b.`id_shop` = 1) LIMIT 1
0.130 ms 1 /src/Adapter/EntityMapper.php:71
340
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.130 ms 1 /classes/Product.php:5670
582
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 2530) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.130 ms 1 /classes/stock/StockAvailable.php:453
51
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 61) AND (b.`id_shop` = 1) LIMIT 1
0.129 ms 1 /src/Adapter/EntityMapper.php:71
132
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1263) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.129 ms 1 /classes/stock/StockAvailable.php:453
352
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.129 ms 1 /classes/Product.php:5670
642
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 2520) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.129 ms 1 /classes/stock/StockAvailable.php:453
717
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 2538
0.129 ms 1 /classes/Product.php:2899
52
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 63) AND (b.`id_shop` = 1) LIMIT 1
0.128 ms 1 /src/Adapter/EntityMapper.php:71
53
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 64) AND (b.`id_shop` = 1) LIMIT 1
0.128 ms 1 /src/Adapter/EntityMapper.php:71
93
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_group`
WHERE `id_group` = 1 LIMIT 1
0.128 ms 1 /classes/Group.php:151
342
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1375 LIMIT 1
0.128 ms 1 /classes/SpecificPrice.php:435
508
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 2542 AND id_shop=1 LIMIT 1
0.128 ms 1 /classes/Product.php:6884
17
SELECT SQL_NO_CACHE * FROM `prstshp_hook_module_exceptions`
WHERE `id_shop` IN (1)
0.128 ms 1 /classes/module/Module.php:2046
139
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1264
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.127 ms 0 /classes/SpecificPrice.php:256
208
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.127 ms 1 /classes/Product.php:5670
436
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 2551 AND id_shop=1 LIMIT 1
0.127 ms 1 /classes/Product.php:6884
300
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1364) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.126 ms 1 /classes/stock/StockAvailable.php:453
550
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.126 ms 1 /classes/Product.php:5670
708
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 2543
0.126 ms 1 /classes/Product.php:2899
232
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.126 ms 1 /classes/Product.php:5670
693
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 2551
0.126 ms 1 /classes/Product.php:2899
142
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1264 AND id_shop=1 LIMIT 1
0.125 ms 1 /classes/Product.php:6884
564
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 2532 LIMIT 1
0.125 ms 1 /classes/SpecificPrice.php:435
234
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1343 LIMIT 1
0.124 ms 1 /classes/SpecificPrice.php:435
720
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 2535
0.124 ms 1 /classes/Product.php:2899
762
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module` WHERE `name` = "ps_languageselector" LIMIT 1
0.124 ms 1 /classes/module/Module.php:2664
175
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1313
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.123 ms 0 /classes/SpecificPrice.php:256
275
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1362 AND `id_group` = 1 LIMIT 1
0.123 ms 0 /classes/GroupReduction.php:153
160
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.123 ms 1 /classes/Product.php:5670
729
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 2530
0.122 ms 1 /classes/Product.php:2899
151
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1265
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.121 ms 0 /classes/SpecificPrice.php:256
214
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1340 AND id_shop=1 LIMIT 1
0.121 ms 1 /classes/Product.php:6884
220
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.121 ms 1 /classes/Product.php:5670
250
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1350 AND id_shop=1 LIMIT 1
0.121 ms 1 /classes/Product.php:6884
393
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.121 ms 1 /classes/Product.php:5670
538
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.121 ms 1 /classes/Product.php:5670
699
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 2547
0.120 ms 1 /classes/Product.php:2899
22
SELECT SQL_NO_CACHE `id_lang` FROM `prstshp_lang`
WHERE `locale` = 'es-es'
OR `language_code` = 'es-es' LIMIT 1
0.120 ms 2 /classes/Language.php:880
226
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1341 AND id_shop=1 LIMIT 1
0.120 ms 1 /classes/Product.php:6884
262
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1361 AND id_shop=1 LIMIT 1
0.120 ms 1 /classes/Product.php:6884
400
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 2556 AND id_shop=1 LIMIT 1
0.120 ms 1 /classes/Product.php:6884
478
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.120 ms 1 /classes/Product.php:5670
202
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1339 AND id_shop=1 LIMIT 1
0.119 ms 1 /classes/Product.php:6884
240
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1343) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.119 ms 1 /classes/stock/StockAvailable.php:453
418
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.119 ms 1 /classes/Product.php:5670
430
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.119 ms 1 /classes/Product.php:5670
448
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 2549 AND id_shop=1 LIMIT 1
0.119 ms 1 /classes/Product.php:6884
469
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 2545
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.119 ms 0 /classes/SpecificPrice.php:256
600
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 2526 LIMIT 1
0.119 ms 1 /classes/SpecificPrice.php:435
606
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 2526) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.119 ms 1 /classes/stock/StockAvailable.php:453
735
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 2526
0.119 ms 1 /classes/Product.php:2899
744
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 2520
0.119 ms 1 /classes/Product.php:2899
797
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module` WHERE `name` = "ps_emailsubscription" LIMIT 1
0.119 ms 1 /classes/module/Module.php:2664
802
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module_shop` WHERE `id_module` = 70 AND `id_shop` = 1 LIMIT 1
0.119 ms 1 /classes/module/Module.php:2137
196
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.118 ms 1 /classes/Product.php:5670
481
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 2544
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.118 ms 0 /classes/SpecificPrice.php:256
490
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.118 ms 1 /classes/Product.php:5670
610
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.118 ms 1 /classes/Product.php:5670
190
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1315 AND id_shop=1 LIMIT 1
0.117 ms 1 /classes/Product.php:6884
252
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1350) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.117 ms 1 /classes/stock/StockAvailable.php:453
670
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.117 ms 1 /classes/Product.php:5670
211
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1340
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.117 ms 1 /classes/SpecificPrice.php:256
60
SELECT SQL_NO_CACHE `need_identification_number`
FROM `prstshp_country`
WHERE `id_country` = 6 LIMIT 1
0.116 ms 1 /classes/Country.php:402
72
SELECT SQL_NO_CACHE *
FROM `prstshp_configuration_lang`
WHERE `id_configuration` = 1315
0.116 ms 1 /src/Adapter/EntityMapper.php:79
127
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1263
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.116 ms 0 /classes/SpecificPrice.php:256
166
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1310 AND id_shop=1 LIMIT 1
0.116 ms 1 /classes/Product.php:6884
179
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1313 AND `id_group` = 1 LIMIT 1
0.116 ms 0 /classes/GroupReduction.php:153
509
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 2542 AND `id_group` = 1 LIMIT 1
0.116 ms 0 /classes/GroupReduction.php:153
442
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.115 ms 1 /classes/Product.php:5670
154
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1265 AND id_shop=1 LIMIT 1
0.115 ms 1 /classes/Product.php:6884
199
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1339
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.115 ms 1 /classes/SpecificPrice.php:256
282
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1363 LIMIT 1
0.115 ms 1 /classes/SpecificPrice.php:435
292
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.115 ms 1 /classes/Product.php:5670
520
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 2541 AND id_shop=1 LIMIT 1
0.115 ms 1 /classes/Product.php:6884
552
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 2533 LIMIT 1
0.115 ms 1 /classes/SpecificPrice.php:435
640
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 2520 AND id_shop=1 LIMIT 1
0.115 ms 1 /classes/Product.php:6884
652
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 2518 AND id_shop=1 LIMIT 1
0.115 ms 1 /classes/Product.php:6884
753
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 2516
0.115 ms 1 /classes/Product.php:2899
68
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module` WHERE `name` = "ps_accounts" LIMIT 1
0.114 ms 1 /src/Adapter/Module/ModuleDataProvider.php:256
27
SELECT SQL_NO_CACHE `id_lang` FROM `prstshp_lang`
WHERE `locale` = 'es-es'
OR `language_code` = 'es-es' LIMIT 1
0.114 ms 2 /classes/Language.php:880
115
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1262
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.114 ms 0 /classes/SpecificPrice.php:256
334
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1374 AND id_shop=1 LIMIT 1
0.114 ms 1 /classes/Product.php:6884
493
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 2543
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.114 ms 0 /classes/SpecificPrice.php:256
580
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 2530 AND id_shop=1 LIMIT 1
0.114 ms 1 /classes/Product.php:6884
581
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 2530 AND `id_group` = 1 LIMIT 1
0.114 ms 0 /classes/GroupReduction.php:153
664
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 2517 AND id_shop=1 LIMIT 1
0.114 ms 1 /classes/Product.php:6884
118
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1262 AND id_shop=1 LIMIT 1
0.113 ms 1 /classes/Product.php:6884
358
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1377 AND id_shop=1 LIMIT 1
0.113 ms 1 /classes/Product.php:6884
472
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 2545 AND id_shop=1 LIMIT 1
0.113 ms 1 /classes/Product.php:6884
570
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 2532) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.113 ms 1 /classes/stock/StockAvailable.php:453
661
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 2517
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.113 ms 0 /classes/SpecificPrice.php:256
75
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `prstshp_category_lang` cl
WHERE `id_lang` = 2
AND cl.id_shop = 1 
AND cl.`id_category` = 18 LIMIT 1
0.112 ms 1 /classes/Category.php:1373
106
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1260 AND id_shop=1 LIMIT 1
0.112 ms 1 /classes/Product.php:6884
270
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1362 LIMIT 1
0.112 ms 1 /classes/SpecificPrice.php:435
294
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1364 LIMIT 1
0.112 ms 1 /classes/SpecificPrice.php:435
336
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1374) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.112 ms 1 /classes/stock/StockAvailable.php:453
370
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1378 AND id_shop=1 LIMIT 1
0.112 ms 1 /classes/Product.php:6884
409
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 2555
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.112 ms 0 /classes/SpecificPrice.php:256
514
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.112 ms 1 /classes/Product.php:5670
484
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 2544 AND id_shop=1 LIMIT 1
0.112 ms 1 /classes/Product.php:6884
364
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.111 ms 1 /classes/Product.php:5670
496
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 2543 AND id_shop=1 LIMIT 1
0.111 ms 1 /classes/Product.php:6884
658
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.111 ms 1 /classes/Product.php:5670
367
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1378
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.111 ms 1 /classes/SpecificPrice.php:256
310
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1365 AND id_shop=1 LIMIT 1
0.110 ms 1 /classes/Product.php:6884
576
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 2530 LIMIT 1
0.110 ms 1 /classes/SpecificPrice.php:435
646
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.110 ms 1 /classes/Product.php:5670
653
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 2518 AND `id_group` = 1 LIMIT 1
0.109 ms 0 /classes/GroupReduction.php:153
178
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1313 AND id_shop=1 LIMIT 1
0.109 ms 1 /classes/Product.php:6884
424
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 2554 AND id_shop=1 LIMIT 1
0.109 ms 1 /classes/Product.php:6884
449
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 2549 AND `id_group` = 1 LIMIT 1
0.109 ms 0 /classes/GroupReduction.php:153
624
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 2521 LIMIT 1
0.109 ms 1 /classes/SpecificPrice.php:435
649
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 2518
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.109 ms 0 /classes/SpecificPrice.php:256
23
SELECT SQL_NO_CACHE value FROM `prstshp_configuration` WHERE `name` = "PS_MULTISHOP_FEATURE_ACTIVE" LIMIT 1
0.108 ms 1 /classes/shop/Shop.php:1183
119
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1262 AND `id_group` = 1 LIMIT 1
0.108 ms 0 /classes/GroupReduction.php:153
130
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1263 AND id_shop=1 LIMIT 1
0.108 ms 1 /classes/Product.php:6884
322
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1373 AND id_shop=1 LIMIT 1
0.108 ms 1 /classes/Product.php:6884
630
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 2521) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.108 ms 1 /classes/stock/StockAvailable.php:453
331
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1374
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.107 ms 1 /classes/SpecificPrice.php:256
346
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1375 AND id_shop=1 LIMIT 1
0.107 ms 1 /classes/Product.php:6884
256
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.107 ms 1 /classes/Product.php:5670
343
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1375
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.106 ms 1 /classes/SpecificPrice.php:256
62
SELECT SQL_NO_CACHE *
FROM `prstshp_country_lang`
WHERE `id_country` = 6
0.106 ms 2 /src/Adapter/EntityMapper.php:79
143
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1264 AND `id_group` = 1 LIMIT 1
0.105 ms 0 /classes/GroupReduction.php:153
397
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 2556
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.105 ms 0 /classes/SpecificPrice.php:256
264
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1361) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.105 ms 1 /classes/stock/StockAvailable.php:453
328
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.105 ms 1 /classes/Product.php:5670
355
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1377
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.105 ms 1 /classes/SpecificPrice.php:256
433
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 2551
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.105 ms 0 /classes/SpecificPrice.php:256
755
SELECT SQL_NO_CACHE c.id_elementor FROM prstshp_iqit_elementor_category c WHERE c.id_category = 18 LIMIT 1
0.105 ms 1 /modules/iqitelementor/src/IqitElementorCategory.php:87
163
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1310
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.104 ms 0 /classes/SpecificPrice.php:256
244
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.104 ms 1 /classes/Product.php:5670
521
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 2541 AND `id_group` = 1 LIMIT 1
0.104 ms 0 /classes/GroupReduction.php:153
796
SELECT SQL_NO_CACHE domain,physical_uri FROM prstshp_shop_url
0.104 ms 1 /modules/corewhatsapp/corewhatsapp.php:179
32
SELECT SQL_NO_CACHE *
FROM `prstshp_currency_lang`
WHERE `id_currency` = 2
0.103 ms 2 /src/Adapter/EntityMapper.php:79
82
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE `to` BETWEEN '2026-04-13 00:00:00' AND '2026-04-13 23:59:59' LIMIT 1
0.103 ms 1 /classes/SpecificPrice.php:381
287
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1363 AND `id_group` = 1 LIMIT 1
0.103 ms 0 /classes/GroupReduction.php:153
505
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 2542
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.103 ms 0 /classes/SpecificPrice.php:256
676
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 2516 AND id_shop=1 LIMIT 1
0.103 ms 1 /classes/Product.php:6884
612
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 2525 LIMIT 1
0.102 ms 1 /classes/SpecificPrice.php:435
798
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module_shop` WHERE `id_module` = 22 AND `id_shop` = 1 LIMIT 1
0.102 ms 1 /classes/module/Module.php:2137
155
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1265 AND `id_group` = 1 LIMIT 1
0.101 ms 0 /classes/GroupReduction.php:153
421
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 2554
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.101 ms 0 /classes/SpecificPrice.php:256
445
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 2549
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.101 ms 0 /classes/SpecificPrice.php:256
37
SELECT SQL_NO_CACHE `id_category`
FROM `prstshp_category_shop`
WHERE `id_category` = 18
AND `id_shop` = 1 LIMIT 1
0.101 ms 1 /classes/Category.php:2446
485
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 2544 AND `id_group` = 1 LIMIT 1
0.101 ms 0 /classes/GroupReduction.php:153
553
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 2533
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.101 ms 0 /classes/SpecificPrice.php:256
673
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 2516
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.101 ms 0 /classes/SpecificPrice.php:256
187
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1315
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.100 ms 0 /classes/SpecificPrice.php:256
235
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1343
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.100 ms 1 /classes/SpecificPrice.php:256
63
SELECT SQL_NO_CACHE *
FROM `prstshp_state` a
WHERE (a.`id_state` = 362) LIMIT 1
0.100 ms 1 /src/Adapter/EntityMapper.php:71
286
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1363 AND id_shop=1 LIMIT 1
0.099 ms 1 /classes/Product.php:6884
306
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1365 LIMIT 1
0.099 ms 1 /classes/SpecificPrice.php:435
26
SELECT SQL_NO_CACHE `id_lang` FROM `prstshp_lang`
WHERE `locale` = 'es-es'
OR `language_code` = 'es-es' LIMIT 1
0.099 ms 2 /classes/Language.php:880
227
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1341 AND `id_group` = 1 LIMIT 1
0.099 ms 0 /classes/GroupReduction.php:153
526
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.099 ms 1 /classes/Product.php:5670
618
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 2525) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.099 ms 1 /classes/stock/StockAvailable.php:453
764
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module` WHERE `name` = "ps_currencyselector" LIMIT 1
0.099 ms 1 /classes/module/Module.php:2664
425
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 2554 AND `id_group` = 1 LIMIT 1
0.098 ms 0 /classes/GroupReduction.php:153
532
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 2538 AND id_shop=1 LIMIT 1
0.098 ms 1 /classes/Product.php:6884
191
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1315 AND `id_group` = 1 LIMIT 1
0.097 ms 0 /classes/GroupReduction.php:153
747
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 2518
0.097 ms 1 /classes/Product.php:2899
215
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1340 AND `id_group` = 1 LIMIT 1
0.096 ms 0 /classes/GroupReduction.php:153
437
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 2551 AND `id_group` = 1 LIMIT 1
0.096 ms 0 /classes/GroupReduction.php:153
238
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1343 AND id_shop=1 LIMIT 1
0.095 ms 1 /classes/Product.php:6884
401
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 2556 AND `id_group` = 1 LIMIT 1
0.095 ms 0 /classes/GroupReduction.php:153
588
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 2528 LIMIT 1
0.095 ms 1 /classes/SpecificPrice.php:435
307
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1365
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.094 ms 0 /classes/SpecificPrice.php:256
750
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 2517
0.094 ms 1 /classes/Product.php:2899
413
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 2555 AND `id_group` = 1 LIMIT 1
0.094 ms 0 /classes/GroupReduction.php:153
283
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1363
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.093 ms 0 /classes/SpecificPrice.php:256
323
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1373 AND `id_group` = 1 LIMIT 1
0.093 ms 0 /classes/GroupReduction.php:153
556
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 2533 AND id_shop=1 LIMIT 1
0.093 ms 1 /classes/Product.php:6884
35
SELECT SQL_NO_CACHE *
FROM `prstshp_group_lang`
WHERE `id_group` = 1
0.092 ms 2 /src/Adapter/EntityMapper.php:79
57
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.092 ms 0 /classes/module/Module.php:2137
311
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1365 AND `id_group` = 1 LIMIT 1
0.092 ms 0 /classes/GroupReduction.php:153
497
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 2543 AND `id_group` = 1 LIMIT 1
0.092 ms 0 /classes/GroupReduction.php:153
562
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.092 ms 1 /classes/Product.php:5670
268
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.091 ms 1 /classes/Product.php:5670
533
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 2538 AND `id_group` = 1 LIMIT 1
0.091 ms 0 /classes/GroupReduction.php:153
544
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 2535 AND id_shop=1 LIMIT 1
0.091 ms 1 /classes/Product.php:6884
24
SELECT SQL_NO_CACHE c.id_currency
FROM `prstshp_currency` c
WHERE (iso_code = 'EUR') LIMIT 1
0.091 ms 1 /classes/Currency.php:893
30
SELECT SQL_NO_CACHE `id_lang` FROM `prstshp_lang`
WHERE `locale` = 'es-es'
OR `language_code` = 'es-es' LIMIT 1
0.091 ms 2 /classes/Language.php:880
259
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1361
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.091 ms 0 /classes/SpecificPrice.php:256
568
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 2532 AND id_shop=1 LIMIT 1
0.091 ms 1 /classes/Product.php:6884
574
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.091 ms 1 /classes/Product.php:5670
107
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1260 AND `id_group` = 1 LIMIT 1
0.090 ms 0 /classes/GroupReduction.php:153
641
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 2520 AND `id_group` = 1 LIMIT 1
0.090 ms 0 /classes/GroupReduction.php:153
763
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module_shop` WHERE `id_module` = 27 AND `id_shop` = 1 LIMIT 1
0.090 ms 1 /classes/module/Module.php:2137
598
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.090 ms 1 /classes/Product.php:5670
634
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.089 ms 1 /classes/Product.php:5670
616
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 2525 AND id_shop=1 LIMIT 1
0.088 ms 1 /classes/Product.php:6884
359
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1377 AND `id_group` = 1 LIMIT 1
0.088 ms 0 /classes/GroupReduction.php:153
628
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 2521 AND id_shop=1 LIMIT 1
0.088 ms 1 /classes/Product.php:6884
665
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 2517 AND `id_group` = 1 LIMIT 1
0.088 ms 0 /classes/GroupReduction.php:153
167
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1310 AND `id_group` = 1 LIMIT 1
0.087 ms 0 /classes/GroupReduction.php:153
298
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1364 AND id_shop=1 LIMIT 1
0.087 ms 1 /classes/Product.php:6884
304
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.087 ms 1 /classes/Product.php:5670
529
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 2538
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.087 ms 0 /classes/SpecificPrice.php:256
677
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 2516 AND `id_group` = 1 LIMIT 1
0.087 ms 0 /classes/GroupReduction.php:153
557
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 2533 AND `id_group` = 1 LIMIT 1
0.086 ms 0 /classes/GroupReduction.php:153
565
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 2532
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.086 ms 0 /classes/SpecificPrice.php:256
64
SELECT SQL_NO_CACHE id_required_field, object_name, field_name
FROM prstshp_required_field
0.086 ms 1 /classes/ObjectModel.php:1592
586
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.085 ms 1 /classes/Product.php:5670
172
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.085 ms 1 /classes/Product.php:5670
316
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.084 ms 1 /classes/Product.php:5670
33
SELECT SQL_NO_CACHE id_shop
FROM `prstshp_currency_shop`
WHERE `id_currency` = 2
AND id_shop = 1 LIMIT 1
0.083 ms 1 /classes/ObjectModel.php:1727
67
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module_shop` WHERE `id_module` = 61 AND `id_shop` = 1 LIMIT 1
0.083 ms 1 /classes/module/Module.php:2137
541
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 2535
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.083 ms 0 /classes/SpecificPrice.php:256
271
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1362
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.082 ms 0 /classes/SpecificPrice.php:256
604
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 2526 AND id_shop=1 LIMIT 1
0.082 ms 1 /classes/Product.php:6884
371
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1378 AND `id_group` = 1 LIMIT 1
0.081 ms 0 /classes/GroupReduction.php:153
577
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 2530
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.081 ms 0 /classes/SpecificPrice.php:256
765
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module_shop` WHERE `id_module` = 17 AND `id_shop` = 1 LIMIT 1
0.081 ms 1 /classes/module/Module.php:2137
131
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1263 AND `id_group` = 1 LIMIT 1
0.081 ms 0 /classes/GroupReduction.php:153
347
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1375 AND `id_group` = 1 LIMIT 1
0.080 ms 0 /classes/GroupReduction.php:153
38
SELECT SQL_NO_CACHE ctg.`id_group`
FROM prstshp_category_group ctg
WHERE ctg.`id_category` = 18 AND ctg.`id_group` = 1 LIMIT 1
0.080 ms 1 /classes/Category.php:1751
239
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1343 AND `id_group` = 1 LIMIT 1
0.079 ms 0 /classes/GroupReduction.php:153
263
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1361 AND `id_group` = 1 LIMIT 1
0.079 ms 0 /classes/GroupReduction.php:153
335
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1374 AND `id_group` = 1 LIMIT 1
0.079 ms 0 /classes/GroupReduction.php:153
545
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 2535 AND `id_group` = 1 LIMIT 1
0.079 ms 0 /classes/GroupReduction.php:153
569
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 2532 AND `id_group` = 1 LIMIT 1
0.079 ms 0 /classes/GroupReduction.php:153
36
SELECT SQL_NO_CACHE id_shop
FROM `prstshp_group_shop`
WHERE `id_group` = 1
AND id_shop = 1 LIMIT 1
0.078 ms 1 /classes/ObjectModel.php:1727
299
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1364 AND `id_group` = 1 LIMIT 1
0.078 ms 0 /classes/GroupReduction.php:153
625
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 2521
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.078 ms 0 /classes/SpecificPrice.php:256
601
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 2526
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.076 ms 0 /classes/SpecificPrice.php:256
629
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 2521 AND `id_group` = 1 LIMIT 1
0.073 ms 0 /classes/GroupReduction.php:153
613
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 2525
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.073 ms 0 /classes/SpecificPrice.php:256
589
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 2528
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.071 ms 0 /classes/SpecificPrice.php:256
295
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1364
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.071 ms 0 /classes/SpecificPrice.php:256
593
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 2528 AND `id_group` = 1 LIMIT 1
0.069 ms 0 /classes/GroupReduction.php:153
617
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 2525 AND `id_group` = 1 LIMIT 1
0.069 ms 0 /classes/GroupReduction.php:153
605
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 2526 AND `id_group` = 1 LIMIT 1
0.067 ms 0 /classes/GroupReduction.php:153

Doubles

49 queries
SELECT XX FROM `prstshp_specific_price` WHERE id_product = XX LIMIT XX
48 queries
SELECT image_shop.`id_image`
                    FROM `prstshp_image` i
                     INNER JOIN prstshp_image_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
                    WHERE i.`id_product` = XX
                    AND image_shop.`cover` = XX LIMIT XX
48 queries
SELECT name FROM prstshp_category_lang WHERE id_shop = XX AND id_lang = XX AND id_category = XX LIMIT XX
48 queries
SELECT *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = XX
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = XX
WHERE (a.`id_product` = XX) AND (b.`id_shop` = XX) LIMIT XX
48 queries
				SELECT `priority`, `id_specific_price_priority`
				FROM `prstshp_specific_price_priority`
				WHERE `id_product` = XX
				ORDER BY `id_specific_price_priority` DESC LIMIT XX
48 queries
			SELECT *, ( IF (`id_group` = XX, XX, XX) +  IF (`id_country` = XX, XX, XX) +  IF (`id_currency` = XX, XX, XX) +  IF (`id_shop` = XX, XX, XX) +  IF (`id_customer` = XX, XX, XX)) AS `score`
				FROM `prstshp_specific_price`
				WHERE
                `id_shop` IN (XX, XX) AND
                `id_currency` IN (XX, XX) AND
                `id_country` IN (XX, XX) AND
                `id_group` IN (XX, XX) AND `id_product` = XX AND `id_customer` = XX AND `id_product_attribute` = XX AND `id_cart` = XX  AND (`from` = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' >= `from`) AND (`to` = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' <= `to`)
				AND IF(`from_quantity` > XX, `from_quantity`, XX) <= XX ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT XX
48 queries
SELECT product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,XX) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = XX)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = XX)
WHERE (p.`id_product` = XX)
48 queries
                            SELECT `id_tax_rules_group`
                            FROM `prstshp_product_shop`
                            WHERE `id_product` = XX AND id_shop=XX LIMIT XX
48 queries
			SELECT `reduction`
			FROM `prstshp_product_group_reduction_cache`
			WHERE `id_product` = XX AND `id_group` = XX LIMIT XX
48 queries
SELECT SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
48 queries
SELECT
            COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), XX) as deep_quantity,
            COALESCE(SUM(first_level_quantity), XX) as quantity
          FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, XX as pack_quantity
          FROM `prstshp_cart_product` cp
            WHERE cp.`id_product_attribute` = XX
            
            AND cp.`id_cart` = XX AND cp.`id_product` = XX UNION SELECT XX as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
          FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
            WHERE cp.`id_product_attribute` = XX
            
            AND cp.`id_cart` = XX AND p.`id_product_item` = XX AND (pr.`pack_stock_type` IN (XX,XX) OR (
            pr.`pack_stock_type` = XX
            AND XX = XX
        ))) as q LIMIT XX
48 queries
                SELECT name, value, pf.id_feature, f.position, fvl.id_feature_value
                FROM prstshp_feature_product pf
                LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = XX)
                LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = XX)
                LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = XX)
                 INNER JOIN prstshp_feature_shop feature_shop
        ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = XX)
                WHERE pf.id_product = XX
                ORDER BY f.position ASC
24 queries
            SELECT image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
            FROM `prstshp_image` i
             INNER JOIN prstshp_image_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
            LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = XX)
            WHERE i.`id_product` = XX
            ORDER BY `position`
24 queries
SELECT `id_product_attribute`
            FROM `prstshp_product_attribute`
            WHERE `id_product` = XX
24 queries
            SELECT pai.`id_image`, pai.`id_product_attribute`, il.`legend`
            FROM `prstshp_product_attribute_image` pai
            LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
            LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
            WHERE pai.`id_product_attribute` IN (XX) AND il.`id_lang` = XX ORDER by i.`position`
24 queries
SELECT pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > XX, XX, XX)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
            FROM `prstshp_product_attribute` pa
             INNER JOIN prstshp_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX) LEFT JOIN prstshp_stock_available stock
            ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, XX) AND stock.id_shop = XX  AND stock.id_shop_group = XX  )
            JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
            JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
            JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = XX)
            JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
            WHERE pa.`id_product` IN (XX) AND ag.`is_color_group` = XX
            GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
            HAVING qty > XX
            ORDER BY a.`position` ASC;
17 queries
SELECT *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = XX
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = XX
WHERE (a.`id_category` = XX) AND (b.`id_shop` = XX) LIMIT XX
9 queries
SELECT `id_module` FROM `prstshp_module_shop` WHERE `id_module` = XX AND `id_shop` = XX LIMIT XX
4 queries
SELECT `id_lang` FROM `prstshp_lang`
                    WHERE `locale` = 'es-es'
                    OR `language_code` = 'es-es' LIMIT XX
3 queries
				SELECT tr.*
				FROM `prstshp_tax_rule` tr
				JOIN `prstshp_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
				WHERE trg.`active` = XX
				AND tr.`id_country` = XX
				AND tr.`id_tax_rules_group` = XX
				AND tr.`id_state` IN (XX, XX)
				AND ('XX' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
					OR (tr.`zipcode_to` = XX AND tr.`zipcode_from` IN(XX, 'XX')))
				ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
2 queries
SELECT value FROM `prstshp_configuration` WHERE `name` = "PS_MULTISHOP_FEATURE_ACTIVE" LIMIT XX
2 queries
SELECT *
FROM `prstshp_currency` a
LEFT JOIN `prstshp_currency_lang` `b` ON a.`id_currency` = b.`id_currency` AND b.`id_lang` = XX
LEFT JOIN `prstshp_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = XX
WHERE (a.`id_currency` = XX) LIMIT XX
2 queries
		SELECT `id_category`
		FROM `prstshp_category_shop`
		WHERE `id_category` = XX
		AND `id_shop` = XX LIMIT XX
2 queries
SELECT *
FROM `prstshp_category` aXX
LEFT JOIN `prstshp_category_lang` `aXX` ON (aXX.`id_category` = aXX.`id_category`)
WHERE (aXX.`nleft` < XX) AND (aXX.`nright` > XX) AND (aXX.`id_lang` = XX) AND (aXX.`id_shop` = XX)
ORDER BY aXX.`nleft` asc
2 queries
SELECT XX FROM `prstshp_cart_rule` WHERE ((date_to >= "XX-XX-XX XX:XX:XX" AND date_to <= "XX-XX-XX XX:XX:XX") OR (date_from >= "XX-XX-XX XX:XX:XX" AND date_from <= "XX-XX-XX XX:XX:XX") OR (date_from < "XX-XX-XX XX:XX:XX" AND date_to > "XX-XX-XX XX:XX:XX")) AND `id_customer` IN (XX,XX) LIMIT XX

Tables stress

150 product
150 product_shop
100 specific_price
98 cart_product
96 image
77 category_lang
76 stock_available
73 product_attribute_shop
73 image_shop
50 product_lang
50 product_attribute
49 image_lang
48 specific_price_priority
48 product_group_reduction_cache
48 pack
48 feature_product
48 feature_lang
48 feature_value_lang
48 feature
48 feature_shop
31 category
26 product_attribute_combination
24 product_attribute_image
24 attribute
24 attribute_lang
24 attribute_group
21 category_shop
14 module
11 module_shop
7 lang
7 hook
7 currency
6 category_group
5 shop_url
5 configuration
5 currency_shop
5 category_product
4 shop
4 lang_shop
3 country
3 hook_alias
3 currency_lang
3 tax_rule
3 tax_rules_group
2 shop_group
2 configuration_lang
2 country_lang
2 country_shop
2 hook_module
2 group
2 group_shop
2 image_type
2 manufacturer
2 product_sale
2 cart_rule
2 psgdpr_consent
1 module_group
1 meta
1 meta_lang
1 hook_module_exceptions
1 group_lang
1 address_format
1 state
1 required_field
1 tax
1 tax_lang
1 layered_category
1 layered_filter_block
1 layered_price_index
1 feature_flag
1 iqit_elementor_category
1 corewhatsapp
1 psgdpr_consent_lang
1 connections

ObjectModel instances

Name Instances Source
Product 96 /classes/Link.php:113 (__construct) [id: 1248]
/classes/Link.php:113 (__construct) [id: 1260]
/classes/Link.php:113 (__construct) [id: 1262]
/classes/Link.php:113 (__construct) [id: 1263]
/classes/Link.php:113 (__construct) [id: 1264]
/classes/Link.php:113 (__construct) [id: 1265]
/classes/Link.php:113 (__construct) [id: 1310]
/classes/Link.php:113 (__construct) [id: 1313]
/classes/Link.php:113 (__construct) [id: 1315]
/classes/Link.php:113 (__construct) [id: 1339]
/classes/Link.php:113 (__construct) [id: 1340]
/classes/Link.php:113 (__construct) [id: 1341]
/classes/Link.php:113 (__construct) [id: 1343]
/classes/Link.php:113 (__construct) [id: 1350]
/classes/Link.php:113 (__construct) [id: 1361]
/classes/Link.php:113 (__construct) [id: 1362]
/classes/Link.php:113 (__construct) [id: 1363]
/classes/Link.php:113 (__construct) [id: 1364]
/classes/Link.php:113 (__construct) [id: 1365]
/classes/Link.php:113 (__construct) [id: 1373]
/classes/Link.php:113 (__construct) [id: 1374]
/classes/Link.php:113 (__construct) [id: 1375]
/classes/Link.php:113 (__construct) [id: 1377]
/classes/Link.php:113 (__construct) [id: 1378]
/classes/Link.php:113 (__construct) [id: 2556]
/classes/Link.php:113 (__construct) [id: 2555]
/classes/Link.php:113 (__construct) [id: 2554]
/classes/Link.php:113 (__construct) [id: 2551]
/classes/Link.php:113 (__construct) [id: 2549]
/classes/Link.php:113 (__construct) [id: 2547]
/classes/Link.php:113 (__construct) [id: 2545]
/classes/Link.php:113 (__construct) [id: 2544]
/classes/Link.php:113 (__construct) [id: 2543]
/classes/Link.php:113 (__construct) [id: 2542]
/classes/Link.php:113 (__construct) [id: 2541]
/classes/Link.php:113 (__construct) [id: 2538]
/classes/Link.php:113 (__construct) [id: 2535]
/classes/Link.php:113 (__construct) [id: 2533]
/classes/Link.php:113 (__construct) [id: 2532]
/classes/Link.php:113 (__construct) [id: 2530]
/classes/Link.php:113 (__construct) [id: 2528]
/classes/Link.php:113 (__construct) [id: 2526]
/classes/Link.php:113 (__construct) [id: 2525]
/classes/Link.php:113 (__construct) [id: 2521]
/classes/Link.php:113 (__construct) [id: 2520]
/classes/Link.php:113 (__construct) [id: 2518]
/classes/Link.php:113 (__construct) [id: 2517]
/classes/Link.php:113 (__construct) [id: 2516]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2556]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2555]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2554]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2551]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2549]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2547]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2545]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2544]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2543]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2542]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2541]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2538]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2535]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2533]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2532]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2530]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2528]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2526]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2525]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2521]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2520]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2518]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2517]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 2516]
/classes/Link.php:113 (__construct) [id: 2556]
/classes/Link.php:113 (__construct) [id: 2555]
/classes/Link.php:113 (__construct) [id: 2554]
/classes/Link.php:113 (__construct) [id: 2551]
/classes/Link.php:113 (__construct) [id: 2549]
/classes/Link.php:113 (__construct) [id: 2547]
/classes/Link.php:113 (__construct) [id: 2545]
/classes/Link.php:113 (__construct) [id: 2544]
/classes/Link.php:113 (__construct) [id: 2543]
/classes/Link.php:113 (__construct) [id: 2542]
/classes/Link.php:113 (__construct) [id: 2541]
/classes/Link.php:113 (__construct) [id: 2538]
/classes/Link.php:113 (__construct) [id: 2535]
/classes/Link.php:113 (__construct) [id: 2533]
/classes/Link.php:113 (__construct) [id: 2532]
/classes/Link.php:113 (__construct) [id: 2530]
/classes/Link.php:113 (__construct) [id: 2528]
/classes/Link.php:113 (__construct) [id: 2526]
/classes/Link.php:113 (__construct) [id: 2525]
/classes/Link.php:113 (__construct) [id: 2521]
/classes/Link.php:113 (__construct) [id: 2520]
/classes/Link.php:113 (__construct) [id: 2518]
/classes/Link.php:113 (__construct) [id: 2517]
/classes/Link.php:113 (__construct) [id: 2516]
Category 24 /controllers/front/listing/CategoryController.php:76 (__construct) [id: 18]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 46]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 48]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 47]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 49]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 50]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 51]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 52]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 53]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 55]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 66]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 56]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 61]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 63]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 64]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 92]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 105]
/classes/Meta.php:379 (__construct) [id: 18]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/classes/Link.php:402 (__construct) [id: 18]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/modules/ps_facetedsearch/src/Filters/Block.php:157 (__construct) [id: 18]
Address 4 /classes/shop/Shop.php:486 (__construct) [id: ]
/classes/Product.php:3694 (initialize) [id: ]
/classes/Product.php:3804 (__construct) [id: ]
/classes/Product.php:5975 (__construct) [id: ]
Currency 3 /src/Adapter/Currency/CurrencyDataProvider.php:101 (__construct) [id: 2]
/src/Adapter/Currency/CurrencyDataProvider.php:101 (__construct) [id: 1]
/classes/Tools.php:691 (getCurrencyInstance) [id: 2]
Country 3 /config/config.inc.php:146 (__construct) [id: 6]
/classes/AddressFormat.php:404 (__construct) [id: 6]
/classes/controller/FrontController.php:1769 (__construct) [id: 6]
State 2 /classes/AddressFormat.php:404 (__construct) [id: 362]
/classes/controller/FrontController.php:1768 (__construct) [id: 362]
Language 2 /config/config.inc.php:211 (__construct) [id: 2]
/classes/Tools.php:561 (__construct) [id: 2]
Tax 2 /classes/tax/TaxRulesTaxManager.php:116 (__construct) [id: 53]
/classes/tax/TaxRulesTaxManager.php:116 (__construct) [id: 53]
Cart 2 /classes/controller/FrontController.php:467 (__construct) [id: ]
/classes/controller/FrontController.php:541 (__construct) [id: ]
Shop 1 /config/config.inc.php:117 (initialize) [id: 1]
IqitElementorCategory 1 /modules/iqitelementor/iqitelementor.php:784 (isJustElementor) [id: ]
Configuration 1 /modules/ps_accounts/src/Adapter/Configuration.php:239 (__construct) [id: 1315]
Gender 1 /classes/controller/FrontController.php:1692 (__construct) [id: 0]
AddressFormat 1 /classes/controller/FrontController.php:1763 (generateAddress) [id: ]
Risk 1 /classes/controller/FrontController.php:1695 (__construct) [id: ]
Group 1 /classes/Cart.php:249 (getCurrent) [id: 1]
Customer 1 /config/config.inc.php:264 (__construct) [id: ]
ShopGroup 1 /classes/shop/Shop.php:561 (__construct) [id: 1]
ConnectionsSource 1 /modules/statsdata/statsdata.php:119 (logHttpReferer) [id: ]

Included Files

# Filename
0 /index.php
1 /config/config.inc.php
2 /config/defines.inc.php
3 /config/autoload.php
4 /vendor/autoload.php
5 /vendor/composer/autoload_real.php
6 /vendor/composer/platform_check.php
7 /vendor/composer/ClassLoader.php
8 /vendor/composer/include_paths.php
9 /vendor/composer/autoload_static.php
10 /vendor/symfony/polyfill-php72/bootstrap.php
11 /vendor/symfony/polyfill-mbstring/bootstrap.php
12 /vendor/symfony/polyfill-mbstring/bootstrap80.php
13 /vendor/symfony/polyfill-intl-normalizer/bootstrap.php
14 /vendor/symfony/polyfill-intl-normalizer/bootstrap80.php
15 /vendor/symfony/polyfill-intl-idn/bootstrap.php
16 /vendor/symfony/deprecation-contracts/function.php
17 /vendor/ralouphie/getallheaders/src/getallheaders.php
18 /vendor/symfony/polyfill-ctype/bootstrap.php
19 /vendor/symfony/polyfill-ctype/bootstrap80.php
20 /vendor/symfony/polyfill-php80/bootstrap.php
21 /vendor/guzzlehttp/promises/src/functions_include.php
22 /vendor/guzzlehttp/promises/src/functions.php
23 /vendor/guzzlehttp/guzzle/src/functions_include.php
24 /vendor/guzzlehttp/guzzle/src/functions.php
25 /vendor/symfony/polyfill-iconv/bootstrap.php
26 /vendor/ezyang/htmlpurifier/library/HTMLPurifier.composer.php
27 /vendor/jakeasmith/http_build_url/src/http_build_url.php
28 /vendor/lcobucci/jwt/compat/class-aliases.php
29 /vendor/lcobucci/jwt/src/Token.php
30 /vendor/lcobucci/jwt/src/Signature.php
31 /vendor/lcobucci/jwt/compat/json-exception-polyfill.php
32 /vendor/lcobucci/jwt/compat/lcobucci-clock-polyfill.php
33 /vendor/swiftmailer/swiftmailer/lib/swift_required.php
34 /vendor/swiftmailer/swiftmailer/lib/classes/Swift.php
35 /vendor/symfony/polyfill-intl-icu/bootstrap.php
36 /vendor/symfony/polyfill-php73/bootstrap.php
37 /vendor/symfony/polyfill-php81/bootstrap.php
38 /vendor/api-platform/core/src/deprecation.php
39 /vendor/api-platform/core/src/Api/FilterInterface.php
40 /vendor/api-platform/core/src/Api/ResourceClassResolverInterface.php
41 /vendor/api-platform/core/src/deprecated_interfaces.php
42 /vendor/api-platform/core/src/Metadata/Property/Factory/PropertyNameCollectionFactoryInterface.php
43 /vendor/api-platform/core/src/Metadata/Resource/Factory/ResourceNameCollectionFactoryInterface.php
44 /vendor/api-platform/core/src/Metadata/Extractor/ResourceExtractorInterface.php
45 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/DateFilterInterface.php
46 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/ExistsFilterInterface.php
47 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/OrderFilterInterface.php
48 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/RangeFilterInterface.php
49 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/SearchFilterInterface.php
50 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationCollectionExtensionInterface.php
51 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationItemExtensionInterface.php
52 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultCollectionExtensionInterface.php
53 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultItemExtensionInterface.php
54 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Filter/FilterInterface.php
55 /vendor/api-platform/core/src/Doctrine/Orm/QueryAwareInterface.php
56 /vendor/api-platform/core/src/Doctrine/Orm/Util/QueryNameGeneratorInterface.php
57 /vendor/api-platform/core/src/Elasticsearch/Metadata/Document/Factory/DocumentMetadataFactoryInterface.php
58 /vendor/api-platform/core/src/Symfony/Validator/ValidationGroupsGeneratorInterface.php
59 /vendor/api-platform/core/src/Symfony/Validator/Exception/ConstraintViolationListAwareExceptionInterface.php
60 /vendor/api-platform/core/src/Exception/ExceptionInterface.php
61 /vendor/api-platform/core/src/Core/Bridge/Symfony/Validator/Metadata/Property/Restriction/PropertySchemaRestrictionMetadataInterface.php
62 /vendor/api-platform/core/src/State/Pagination/PaginatorInterface.php
63 /vendor/api-platform/core/src/State/Pagination/PartialPaginatorInterface.php
64 /vendor/api-platform/core/src/Documentation/DocumentationInterface.php
65 /vendor/api-platform/core/src/JsonLd/AnonymousContextBuilderInterface.php
66 /vendor/api-platform/core/src/JsonLd/ContextBuilderInterface.php
67 /vendor/api-platform/core/src/Core/JsonSchema/SchemaFactoryInterface.php
68 /vendor/api-platform/core/src/JsonSchema/TypeFactoryInterface.php
69 /vendor/api-platform/core/src/OpenApi/Factory/OpenApiFactoryInterface.php
70 /vendor/api-platform/core/src/PathResolver/OperationPathResolverInterface.php
71 /vendor/api-platform/core/src/Symfony/Security/ResourceAccessCheckerInterface.php
72 /vendor/api-platform/core/src/Serializer/Filter/FilterInterface.php
73 /vendor/api-platform/core/src/Serializer/SerializerContextBuilderInterface.php
74 /vendor/api-platform/core/src/Validator/ValidatorInterface.php
75 /vendor/api-platform/core/src/Api/UrlGeneratorInterface.php
76 /vendor/api-platform/core/src/GraphQl/ExecutorInterface.php
77 /vendor/api-platform/core/src/GraphQl/Error/ErrorHandlerInterface.php
78 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ValidateStageInterface.php
79 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ReadStageInterface.php
80 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityPostDenormalizeStageInterface.php
81 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityStageInterface.php
82 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/WriteStageInterface.php
83 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SerializeStageInterface.php
84 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/DeserializeStageInterface.php
85 /vendor/api-platform/core/src/GraphQl/Resolver/QueryItemResolverInterface.php
86 /vendor/api-platform/core/src/GraphQl/Resolver/QueryCollectionResolverInterface.php
87 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Factory/ResolverFactoryInterface.php
88 /vendor/api-platform/core/src/GraphQl/Resolver/MutationResolverInterface.php
89 /vendor/api-platform/core/src/Core/GraphQl/Subscription/MercureSubscriptionIriGeneratorInterface.php
90 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionIdentifierGeneratorInterface.php
91 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionManagerInterface.php
92 /vendor/api-platform/core/src/Core/GraphQl/Serializer/SerializerContextBuilderInterface.php
93 /vendor/api-platform/core/src/GraphQl/Type/TypesFactoryInterface.php
94 /vendor/api-platform/core/src/GraphQl/Type/Definition/TypeInterface.php
95 /vendor/api-platform/core/src/GraphQl/Type/TypesContainerInterface.php
96 /vendor/psr/container/src/ContainerInterface.php
97 /vendor/api-platform/core/src/Operation/PathSegmentNameGeneratorInterface.php
98 /vendor/ircmaxell/password-compat/lib/password.php
99 /vendor/martinlindhe/php-mb-helpers/src/mb_helpers.php
100 /vendor/prestashop/laminas-code-lts/polyfill/ReflectionEnumPolyfill.php
101 /src/Core/Version.php
102 /config/alias.php
103 /vendor/prestashop/autoload/src/PrestashopAutoload.php
104 /vendor/prestashop/autoload/src/LegacyClassLoader.php
105 /vendor/symfony/symfony/src/Symfony/Component/Filesystem/Filesystem.php
106 /vendor/prestashop/autoload/src/Autoloader.php
107 /config/bootstrap.php
108 /src/Core/ContainerBuilder.php
109 /src/Core/Foundation/IoC/Container.php
110 /src/Adapter/ServiceLocator.php
111 /var/cache/prod/appParameters.php
114 /var/cache/prod/class_index.php
115 /classes/controller/Controller.php
117 /classes/ObjectModel.php
118 /src/Core/Foundation/Database/EntityInterface.php
120 /classes/db/Db.php
122 /classes/Hook.php
124 /classes/module/Module.php
125 /src/Core/Module/Legacy/ModuleInterface.php
127 /classes/Tools.php
128 /classes/Context.php
129 /classes/shop/Shop.php
130 /src/Core/Security/PasswordGenerator.php
131 /classes/db/DbPDO.php
132 /classes/AddressFormat.php
133 /classes/Configuration.php
134 /classes/Validate.php
135 /classes/cache/Cache.php
136 /src/Adapter/EntityMapper.php
137 /classes/db/DbQuery.php
138 /src/Core/Addon/Theme/ThemeManagerBuilder.php
139 /vendor/psr/log/Psr/Log/NullLogger.php
140 /vendor/psr/log/Psr/Log/AbstractLogger.php
141 /vendor/psr/log/Psr/Log/LoggerInterface.php
142 /src/Adapter/Configuration.php
143 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ParameterBag.php
144 /src/Core/Domain/Configuration/ShopConfigurationInterface.php
145 /src/Core/ConfigurationInterface.php
146 /src/Core/Addon/Theme/ThemeRepository.php
147 /src/Core/Addon/AddonRepositoryInterface.php
148 /src/Core/Domain/Shop/ValueObject/ShopConstraint.php
149 /src/Core/Addon/Theme/Theme.php
150 /src/Core/Addon/AddonInterface.php
151 /src/Core/Util/ArrayFinder.php
152 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccess.php
153 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorBuilder.php
154 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessor.php
155 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorInterface.php
156 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPath.php
157 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPathInterface.php
158 /config/defines_uri.inc.php
159 /classes/Language.php
160 /src/Core/Language/LanguageInterface.php
161 /classes/Country.php
162 /classes/PrestaShopCollection.php
163 /classes/shop/ShopGroup.php
164 /classes/Cookie.php
165 /classes/PhpEncryption.php
166 /classes/PhpEncryptionEngine.php
167 /vendor/defuse/php-encryption/src/Key.php
168 /vendor/defuse/php-encryption/src/Encoding.php
169 /vendor/defuse/php-encryption/src/Core.php
170 /vendor/defuse/php-encryption/src/Crypto.php
171 /vendor/defuse/php-encryption/src/KeyOrPassword.php
172 /vendor/defuse/php-encryption/src/RuntimeTests.php
173 /vendor/defuse/php-encryption/src/DerivedKeys.php
174 /vendor/defuse/php-encryption/src/Exception/WrongKeyOrModifiedCiphertextException.php
175 /vendor/defuse/php-encryption/src/Exception/CryptoException.php
176 /src/Core/Session/SessionHandler.php
177 /src/Core/Session/SessionHandlerInterface.php
178 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Session.php
179 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBag.php
180 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBagInterface.php
181 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagInterface.php
182 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBag.php
183 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBagInterface.php
184 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagProxy.php
185 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionInterface.php
186 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/PhpBridgeSessionStorage.php
187 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/NativeSessionStorage.php
188 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/MetadataBag.php
189 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/StrictSessionHandler.php
190 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/AbstractSessionHandler.php
191 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/SessionHandlerProxy.php
192 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/AbstractProxy.php
193 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/SessionStorageInterface.php
194 /config/smarty.config.inc.php
195 /vendor/smarty/smarty/libs/Smarty.class.php
196 /vendor/smarty/smarty/libs/functions.php
197 /vendor/smarty/smarty/libs/Autoloader.php
198 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_data.php
199 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_extension_handler.php
200 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php
201 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php
202 /vendor/smarty/smarty/libs/sysplugins/smarty_resource.php
203 /vendor/smarty/smarty/libs/sysplugins/smarty_variable.php
204 /vendor/smarty/smarty/libs/sysplugins/smarty_template_source.php
205 /vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php
206 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_resource_file.php
207 /config/smartyfront.config.inc.php
208 /classes/Smarty/SmartyResourceModule.php
209 /vendor/smarty/smarty/libs/sysplugins/smarty_resource_custom.php
210 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerresource.php
211 /classes/Smarty/SmartyResourceParent.php
212 /classes/Smarty/SmartyLazyRegister.php
213 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerplugin.php
214 /vendor/smarty/smarty/libs/plugins/modifier.truncate.php
215 /classes/Customer.php
216 /classes/Group.php
217 /classes/Link.php
218 /classes/shop/ShopUrl.php
219 /classes/Dispatcher.php
220 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Request.php
221 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeader.php
222 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeaderItem.php
223 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/FileBag.php
224 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderBag.php
225 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderUtils.php
226 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ServerBag.php
227 /src/Adapter/SymfonyContainer.php
228 /vendor/mobiledetect/mobiledetectlib/Mobile_Detect.php
229 /config/db_slave_server.inc.php
230 /src/Adapter/ContainerBuilder.php
231 /src/Adapter/Environment.php
232 /src/Core/EnvironmentInterface.php
233 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCache.php
234 /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerConfigCache.php
235 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheInterface.php
236 /vendor/symfony/symfony/src/Symfony/Component/Cache/DoctrineProvider.php
237 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/CacheProvider.php
238 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Cache.php
239 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/FlushableCache.php
240 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/ClearableCache.php
241 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiOperationCache.php
242 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiGetCache.php
243 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiDeleteCache.php
244 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiPutCache.php
245 /vendor/symfony/symfony/src/Symfony/Component/Cache/PruneableInterface.php
246 /vendor/symfony/symfony/src/Symfony/Component/Cache/ResettableInterface.php
247 /vendor/symfony/contracts/Service/ResetInterface.php
248 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/ArrayAdapter.php
249 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ArrayTrait.php
250 /vendor/psr/log/Psr/Log/LoggerAwareTrait.php
251 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AdapterInterface.php
252 /vendor/symfony/symfony/src/Symfony/Component/Cache/CacheItem.php
253 /vendor/symfony/contracts/Cache/ItemInterface.php
254 /vendor/psr/cache/src/CacheItemInterface.php
255 /vendor/psr/cache/src/CacheItemPoolInterface.php
256 /vendor/symfony/contracts/Cache/CacheInterface.php
257 /vendor/psr/log/Psr/Log/LoggerAwareInterface.php
258 /vendor/doctrine/orm/lib/Doctrine/ORM/Tools/Setup.php
259 /vendor/doctrine/deprecations/lib/Doctrine/Deprecations/Deprecation.php
260 /vendor/doctrine/orm/lib/Doctrine/ORM/Configuration.php
261 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Configuration.php
262 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/CacheAdapter.php
263 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/DoctrineProvider.php
264 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationReader.php
265 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Reader.php
266 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationRegistry.php
267 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/DoctrineAnnotations.php
268 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Annotation.php
269 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Entity.php
270 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embeddable.php
271 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embedded.php
272 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/MappedSuperclass.php
273 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/InheritanceType.php
274 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorColumn.php
275 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorMap.php
276 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Id.php
277 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/GeneratedValue.php
278 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Version.php
279 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumn.php
280 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumns.php
281 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Column.php
282 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToOne.php
283 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToMany.php
284 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToOne.php
285 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToMany.php
286 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Table.php
287 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/UniqueConstraint.php
288 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Index.php
289 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinTable.php
290 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SequenceGenerator.php
291 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/CustomIdGenerator.php
292 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ChangeTrackingPolicy.php
293 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OrderBy.php
294 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQueries.php
295 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQuery.php
296 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/HasLifecycleCallbacks.php
297 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PrePersist.php
298 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostPersist.php
299 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreUpdate.php
300 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostUpdate.php
301 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreRemove.php
302 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostRemove.php
303 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostLoad.php
304 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreFlush.php
305 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/FieldResult.php
306 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ColumnResult.php
307 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityResult.php
308 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQuery.php
309 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQueries.php
310 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMapping.php
311 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMappings.php
312 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverride.php
313 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverrides.php
314 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverride.php
315 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverrides.php
316 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityListeners.php
317 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Cache.php
318 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/SimpleAnnotationReader.php
319 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocParser.php
320 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocLexer.php
321 /vendor/doctrine/lexer/lib/Doctrine/Common/Lexer/AbstractLexer.php
322 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Target.php
323 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/AnnotationDriver.php
324 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/CompatibilityAnnotationDriver.php
325 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/MappingDriver.php
326 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/ColocatedMappingDriver.php
327 /var/cache/prod/FrontContainer.php
328 /src/Adapter/Container/LegacyContainer.php
329 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Container.php
330 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/RewindableGenerator.php
331 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/ServiceLocator.php
332 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ServiceLocator.php
333 /vendor/symfony/contracts/Service/ServiceLocatorTrait.php
334 /vendor/psr/container/src/ContainerExceptionInterface.php
335 /vendor/psr/container/src/NotFoundExceptionInterface.php
336 /vendor/symfony/contracts/Service/ServiceProviderInterface.php
337 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ResettableContainerInterface.php
338 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ContainerInterface.php
339 /src/Adapter/Container/LegacyContainerInterface.php
340 /modules/blockwishlist/vendor/autoload.php
341 /modules/blockwishlist/vendor/composer/autoload_real.php
342 /modules/blockwishlist/vendor/composer/autoload_static.php
343 /modules/contactform/vendor/autoload.php
344 /modules/contactform/vendor/composer/autoload_real.php
345 /modules/contactform/vendor/composer/autoload_static.php
346 /modules/dashactivity/vendor/autoload.php
347 /modules/dashactivity/vendor/composer/autoload_real.php
348 /modules/dashactivity/vendor/composer/autoload_static.php
349 /modules/dashtrends/vendor/autoload.php
350 /modules/dashtrends/vendor/composer/autoload_real.php
351 /modules/dashtrends/vendor/composer/autoload_static.php
352 /modules/dashgoals/vendor/autoload.php
353 /modules/dashgoals/vendor/composer/autoload_real.php
354 /modules/dashgoals/vendor/composer/autoload_static.php
355 /modules/dashproducts/vendor/autoload.php
356 /modules/dashproducts/vendor/composer/autoload_real.php
357 /modules/dashproducts/vendor/composer/platform_check.php
358 /modules/dashproducts/vendor/composer/autoload_static.php
359 /modules/graphnvd3/vendor/autoload.php
360 /modules/graphnvd3/vendor/composer/autoload_real.php
361 /modules/graphnvd3/vendor/composer/autoload_static.php
362 /modules/gridhtml/vendor/autoload.php
363 /modules/gridhtml/vendor/composer/autoload_real.php
364 /modules/gridhtml/vendor/composer/autoload_static.php
365 /modules/gsitemap/vendor/autoload.php
366 /modules/gsitemap/vendor/composer/autoload_real.php
367 /modules/gsitemap/vendor/composer/platform_check.php
368 /modules/gsitemap/vendor/composer/autoload_static.php
369 /modules/pagesnotfound/vendor/autoload.php
370 /modules/pagesnotfound/vendor/composer/autoload_real.php
371 /modules/pagesnotfound/vendor/composer/platform_check.php
372 /modules/pagesnotfound/vendor/composer/autoload_static.php
373 /modules/productcomments/vendor/autoload.php
374 /modules/productcomments/vendor/composer/autoload_real.php
375 /modules/productcomments/vendor/composer/platform_check.php
376 /modules/productcomments/vendor/composer/autoload_static.php
377 /modules/ps_checkpayment/vendor/autoload.php
378 /modules/ps_checkpayment/vendor/composer/autoload_real.php
379 /modules/ps_checkpayment/vendor/composer/autoload_static.php
380 /modules/ps_contactinfo/vendor/autoload.php
381 /modules/ps_contactinfo/vendor/composer/autoload_real.php
382 /modules/ps_contactinfo/vendor/composer/autoload_static.php
383 /modules/ps_crossselling/vendor/autoload.php
384 /modules/ps_crossselling/vendor/composer/autoload_real.php
385 /modules/ps_crossselling/vendor/composer/platform_check.php
386 /modules/ps_crossselling/vendor/composer/autoload_static.php
387 /modules/ps_currencyselector/vendor/autoload.php
388 /modules/ps_currencyselector/vendor/composer/autoload_real.php
389 /modules/ps_currencyselector/vendor/composer/autoload_static.php
390 /modules/ps_customeraccountlinks/vendor/autoload.php
391 /modules/ps_customeraccountlinks/vendor/composer/autoload_real.php
392 /modules/ps_customeraccountlinks/vendor/composer/autoload_static.php
393 /modules/ps_customtext/vendor/autoload.php
394 /modules/ps_customtext/vendor/composer/autoload_real.php
395 /modules/ps_customtext/vendor/composer/platform_check.php
396 /modules/ps_customtext/vendor/composer/autoload_static.php
397 /modules/ps_dataprivacy/vendor/autoload.php
398 /modules/ps_dataprivacy/vendor/composer/autoload_real.php
399 /modules/ps_dataprivacy/vendor/composer/autoload_static.php
400 /modules/ps_emailsubscription/vendor/autoload.php
401 /modules/ps_emailsubscription/vendor/composer/autoload_real.php
402 /modules/ps_emailsubscription/vendor/composer/platform_check.php
403 /modules/ps_emailsubscription/vendor/composer/autoload_static.php
404 /modules/ps_faviconnotificationbo/vendor/autoload.php
405 /modules/ps_faviconnotificationbo/vendor/composer/autoload_real.php
406 /modules/ps_faviconnotificationbo/vendor/composer/platform_check.php
407 /modules/ps_faviconnotificationbo/vendor/composer/autoload_static.php
408 /modules/ps_featuredproducts/vendor/autoload.php
409 /modules/ps_featuredproducts/vendor/composer/autoload_real.php
410 /modules/ps_featuredproducts/vendor/composer/platform_check.php
411 /modules/ps_featuredproducts/vendor/composer/autoload_static.php
412 /modules/ps_imageslider/vendor/autoload.php
413 /modules/ps_imageslider/vendor/composer/autoload_real.php
414 /modules/ps_imageslider/vendor/composer/platform_check.php
415 /modules/ps_imageslider/vendor/composer/autoload_static.php
416 /modules/ps_languageselector/vendor/autoload.php
417 /modules/ps_languageselector/vendor/composer/autoload_real.php
418 /modules/ps_languageselector/vendor/composer/autoload_static.php
419 /modules/ps_linklist/vendor/autoload.php
420 /modules/ps_linklist/vendor/composer/autoload_real.php
421 /modules/ps_linklist/vendor/composer/autoload_static.php
422 /modules/ps_mainmenu/vendor/autoload.php
423 /modules/ps_mainmenu/vendor/composer/autoload_real.php
424 /modules/ps_mainmenu/vendor/composer/platform_check.php
425 /modules/ps_mainmenu/vendor/composer/autoload_static.php
426 /modules/ps_searchbar/vendor/autoload.php
427 /modules/ps_searchbar/vendor/composer/autoload_real.php
428 /modules/ps_searchbar/vendor/composer/autoload_static.php
429 /modules/ps_sharebuttons/vendor/autoload.php
430 /modules/ps_sharebuttons/vendor/composer/autoload_real.php
431 /modules/ps_sharebuttons/vendor/composer/autoload_static.php
432 /modules/ps_shoppingcart/vendor/autoload.php
433 /modules/ps_shoppingcart/vendor/composer/autoload_real.php
434 /modules/ps_shoppingcart/vendor/composer/autoload_static.php
435 /modules/ps_socialfollow/vendor/autoload.php
436 /modules/ps_socialfollow/vendor/composer/autoload_real.php
437 /modules/ps_socialfollow/vendor/composer/platform_check.php
438 /modules/ps_socialfollow/vendor/composer/autoload_static.php
439 /modules/ps_themecusto/vendor/autoload.php
440 /modules/ps_themecusto/vendor/composer/autoload_real.php
441 /modules/ps_themecusto/vendor/composer/autoload_static.php
442 /modules/ps_wirepayment/vendor/autoload.php
443 /modules/ps_wirepayment/vendor/composer/autoload_real.php
444 /modules/ps_wirepayment/vendor/composer/platform_check.php
445 /modules/ps_wirepayment/vendor/composer/autoload_static.php
446 /modules/statsbestcategories/vendor/autoload.php
447 /modules/statsbestcategories/vendor/composer/autoload_real.php
448 /modules/statsbestcategories/vendor/composer/platform_check.php
449 /modules/statsbestcategories/vendor/composer/autoload_static.php
450 /modules/statsbestcustomers/vendor/autoload.php
451 /modules/statsbestcustomers/vendor/composer/autoload_real.php
452 /modules/statsbestcustomers/vendor/composer/platform_check.php
453 /modules/statsbestcustomers/vendor/composer/autoload_static.php
454 /modules/statsbestproducts/vendor/autoload.php
455 /modules/statsbestproducts/vendor/composer/autoload_real.php
456 /modules/statsbestproducts/vendor/composer/platform_check.php
457 /modules/statsbestproducts/vendor/composer/autoload_static.php
458 /modules/statsbestsuppliers/vendor/autoload.php
459 /modules/statsbestsuppliers/vendor/composer/autoload_real.php
460 /modules/statsbestsuppliers/vendor/composer/platform_check.php
461 /modules/statsbestsuppliers/vendor/composer/autoload_static.php
462 /modules/statsbestvouchers/vendor/autoload.php
463 /modules/statsbestvouchers/vendor/composer/autoload_real.php
464 /modules/statsbestvouchers/vendor/composer/platform_check.php
465 /modules/statsbestvouchers/vendor/composer/autoload_static.php
466 /modules/statscarrier/vendor/autoload.php
467 /modules/statscarrier/vendor/composer/autoload_real.php
468 /modules/statscarrier/vendor/composer/platform_check.php
469 /modules/statscarrier/vendor/composer/autoload_static.php
470 /modules/statscatalog/vendor/autoload.php
471 /modules/statscatalog/vendor/composer/autoload_real.php
472 /modules/statscatalog/vendor/composer/platform_check.php
473 /modules/statscatalog/vendor/composer/autoload_static.php
474 /modules/statscheckup/vendor/autoload.php
475 /modules/statscheckup/vendor/composer/autoload_real.php
476 /modules/statscheckup/vendor/composer/platform_check.php
477 /modules/statscheckup/vendor/composer/autoload_static.php
478 /modules/statsdata/vendor/autoload.php
479 /modules/statsdata/vendor/composer/autoload_real.php
480 /modules/statsdata/vendor/composer/platform_check.php
481 /modules/statsdata/vendor/composer/autoload_static.php
482 /modules/statsforecast/vendor/autoload.php
483 /modules/statsforecast/vendor/composer/autoload_real.php
484 /modules/statsforecast/vendor/composer/platform_check.php
485 /modules/statsforecast/vendor/composer/autoload_static.php
486 /modules/statsnewsletter/vendor/autoload.php
487 /modules/statsnewsletter/vendor/composer/autoload_real.php
488 /modules/statsnewsletter/vendor/composer/platform_check.php
489 /modules/statsnewsletter/vendor/composer/autoload_static.php
490 /modules/statspersonalinfos/vendor/autoload.php
491 /modules/statspersonalinfos/vendor/composer/autoload_real.php
492 /modules/statspersonalinfos/vendor/composer/platform_check.php
493 /modules/statspersonalinfos/vendor/composer/autoload_static.php
494 /modules/statsproduct/vendor/autoload.php
495 /modules/statsproduct/vendor/composer/autoload_real.php
496 /modules/statsproduct/vendor/composer/platform_check.php
497 /modules/statsproduct/vendor/composer/autoload_static.php
498 /modules/statsregistrations/vendor/autoload.php
499 /modules/statsregistrations/vendor/composer/autoload_real.php
500 /modules/statsregistrations/vendor/composer/platform_check.php
501 /modules/statsregistrations/vendor/composer/autoload_static.php
502 /modules/statssales/vendor/autoload.php
503 /modules/statssales/vendor/composer/autoload_real.php
504 /modules/statssales/vendor/composer/platform_check.php
505 /modules/statssales/vendor/composer/autoload_static.php
506 /modules/statssearch/vendor/autoload.php
507 /modules/statssearch/vendor/composer/autoload_real.php
508 /modules/statssearch/vendor/composer/platform_check.php
509 /modules/statssearch/vendor/composer/autoload_static.php
510 /modules/statsstock/vendor/autoload.php
511 /modules/statsstock/vendor/composer/autoload_real.php
512 /modules/statsstock/vendor/composer/platform_check.php
513 /modules/statsstock/vendor/composer/autoload_static.php
514 /modules/psgdpr/vendor/autoload.php
515 /modules/psgdpr/vendor/composer/autoload_real.php
516 /modules/psgdpr/vendor/composer/autoload_static.php
517 /modules/ps_metrics/vendor/autoload.php
518 /modules/ps_metrics/vendor/composer/autoload_real.php
519 /modules/ps_metrics/vendor/composer/autoload_static.php
520 /modules/ps_metrics/vendor/symfony/polyfill-php80/bootstrap.php
521 /modules/ps_metrics/vendor/symfony/deprecation-contracts/function.php
522 /modules/ps_metrics/vendor/symfony/polyfill-mbstring/bootstrap.php
523 /modules/ps_metrics/vendor/symfony/polyfill-mbstring/bootstrap80.php
524 /modules/ps_metrics/vendor/symfony/polyfill-ctype/bootstrap.php
525 /modules/ps_metrics/vendor/symfony/polyfill-ctype/bootstrap80.php
526 /modules/ps_metrics/vendor/symfony/polyfill-php73/bootstrap.php
527 /modules/ps_metrics/vendor/symfony/polyfill-intl-grapheme/bootstrap.php
528 /modules/ps_metrics/vendor/symfony/polyfill-intl-normalizer/bootstrap.php
529 /modules/ps_metrics/vendor/symfony/polyfill-intl-normalizer/bootstrap80.php
530 /modules/ps_metrics/vendor/symfony/string/Resources/functions.php
531 /modules/ps_metrics/vendor/clue/stream-filter/src/functions_include.php
532 /modules/ps_metrics/vendor/clue/stream-filter/src/functions.php
533 /modules/ps_metrics/vendor/ralouphie/getallheaders/src/getallheaders.php
534 /modules/ps_metrics/vendor/guzzlehttp/psr7/src/functions_include.php
535 /modules/ps_metrics/vendor/guzzlehttp/psr7/src/functions.php
536 /modules/ps_metrics/vendor/php-http/message/src/filters.php
537 /modules/ps_metrics/vendor/symfony/polyfill-php81/bootstrap.php
538 /modules/ps_metrics/vendor/phpstan/phpstan/bootstrap.php
539 /modules/ps_metrics/vendor/segmentio/analytics-php/lib/Segment.php
540 /modules/ps_metrics/vendor/segmentio/analytics-php/lib/Segment/Client.php
541 /modules/ps_metrics/vendor/segmentio/analytics-php/lib/Segment/Consumer.php
542 /modules/ps_metrics/vendor/segmentio/analytics-php/lib/Segment/QueueConsumer.php
543 /modules/ps_metrics/vendor/segmentio/analytics-php/lib/Segment/Consumer/File.php
544 /modules/ps_metrics/vendor/segmentio/analytics-php/lib/Segment/Consumer/ForkCurl.php
545 /modules/ps_metrics/vendor/segmentio/analytics-php/lib/Segment/Consumer/Socket.php
546 /modules/ps_facebook/vendor/autoload.php
547 /modules/ps_facebook/vendor/composer/autoload_real.php
548 /modules/ps_facebook/vendor/composer/autoload_static.php
549 /modules/ps_facebook/vendor/segmentio/analytics-php/lib/Segment.php
550 /modules/ps_facebook/vendor/segmentio/analytics-php/lib/Segment/Client.php
551 /modules/ps_facebook/vendor/segmentio/analytics-php/lib/Segment/Consumer.php
552 /modules/ps_facebook/vendor/segmentio/analytics-php/lib/Segment/QueueConsumer.php
553 /modules/ps_facebook/vendor/segmentio/analytics-php/lib/Segment/Consumer/File.php
554 /modules/ps_facebook/vendor/segmentio/analytics-php/lib/Segment/Consumer/ForkCurl.php
555 /modules/ps_facebook/vendor/segmentio/analytics-php/lib/Segment/Consumer/LibCurl.php
556 /modules/ps_facebook/vendor/segmentio/analytics-php/lib/Segment/Consumer/Socket.php
557 /modules/ps_facebook/vendor/segmentio/analytics-php/lib/Segment/Version.php
558 /modules/psxmarketingwithgoogle/vendor/autoload.php
559 /modules/psxmarketingwithgoogle/vendor/composer/autoload_real.php
560 /modules/psxmarketingwithgoogle/vendor/composer/autoload_static.php
561 /modules/blockreassurance/vendor/autoload.php
562 /modules/blockreassurance/vendor/composer/autoload_real.php
563 /modules/blockreassurance/vendor/composer/autoload_static.php
564 /modules/ps_facetedsearch/vendor/autoload.php
565 /modules/ps_facetedsearch/vendor/composer/autoload_real.php
566 /modules/ps_facetedsearch/vendor/composer/platform_check.php
567 /modules/ps_facetedsearch/vendor/composer/autoload_static.php
568 /modules/ps_emailalerts/vendor/autoload.php
569 /modules/ps_emailalerts/vendor/composer/autoload_real.php
570 /modules/ps_emailalerts/vendor/composer/autoload_static.php
571 /modules/ps_categorytree/vendor/autoload.php
572 /modules/ps_categorytree/vendor/composer/autoload_real.php
573 /modules/ps_categorytree/vendor/composer/platform_check.php
574 /modules/ps_categorytree/vendor/composer/autoload_static.php
575 /modules/ps_distributionapiclient/vendor/autoload.php
576 /modules/ps_distributionapiclient/vendor/composer/autoload_real.php
577 /modules/ps_distributionapiclient/vendor/composer/platform_check.php
578 /modules/ps_distributionapiclient/vendor/composer/autoload_static.php
579 /modules/ps_distributionapiclient/vendor/symfony/polyfill-intl-grapheme/bootstrap.php
580 /modules/ps_distributionapiclient/vendor/symfony/string/Resources/functions.php
581 /src/Core/Hook/HookModuleFilter.php
582 /src/Core/Hook/HookModuleFilterInterface.php
583 /controllers/front/listing/CategoryController.php
584 /classes/controller/ProductListingFrontController.php
585 /classes/controller/ProductPresentingFrontController.php
586 /classes/controller/FrontController.php
587 /src/PrestaShopBundle/Translation/TranslatorComponent.php
588 /vendor/symfony/symfony/src/Symfony/Component/Translation/Translator.php
589 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorInterface.php
590 /vendor/symfony/contracts/Translation/LocaleAwareInterface.php
591 /vendor/symfony/contracts/Translation/TranslatorInterface.php
592 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorBagInterface.php
593 /src/PrestaShopBundle/Translation/PrestaShopTranslatorTrait.php
594 /src/PrestaShopBundle/Translation/TranslatorLanguageTrait.php
595 /src/PrestaShopBundle/Translation/TranslatorInterface.php
596 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatter.php
597 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatter.php
598 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatterInterface.php
599 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatterInterface.php
600 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/ChoiceMessageFormatterInterface.php
601 /vendor/symfony/symfony/src/Symfony/Component/Translation/IdentityTranslator.php
602 /vendor/symfony/contracts/Translation/TranslatorTrait.php
603 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactory.php
604 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactoryInterface.php
605 /var/cache/prod/translations/catalogue.es-ES.NXhscRe.php
606 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogue.php
607 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogueInterface.php
608 /vendor/symfony/symfony/src/Symfony/Component/Translation/MetadataAwareInterface.php
609 /src/Adapter/Presenter/Object/ObjectPresenter.php
610 /src/Adapter/Presenter/PresenterInterface.php
611 /src/Adapter/Presenter/Cart/CartPresenter.php
612 /src/Adapter/Image/ImageRetriever.php
613 /classes/tax/TaxConfiguration.php
614 /classes/Smarty/TemplateFinder.php
615 /classes/assets/StylesheetManager.php
616 /classes/assets/AbstractAssetManager.php
617 /src/Adapter/Assets/AssetUrlGeneratorTrait.php
618 /classes/assets/JavascriptManager.php
619 /classes/assets/CccReducer.php
620 /modules/iqitthemeeditor/iqitthemeeditor.php
621 /modules/iqitthemeeditor/src/IqitSmartyModifiers.php
622 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_createdata.php
623 /vendor/smarty/smarty/libs/sysplugins/smarty_data.php
624 /classes/Translate.php
625 /modules/iqitthemeeditor/translations/es.php
626 /classes/Category.php
627 /classes/webservice/WebserviceRequest.php
628 /src/Core/Localization/Locale/Repository.php
629 /src/Core/Localization/Locale/RepositoryInterface.php
630 /src/Core/Localization/CLDR/LocaleRepository.php
631 /src/Core/Localization/CLDR/LocaleDataSource.php
632 /src/Core/Localization/CLDR/DataLayer/LocaleCache.php
633 /src/Core/Data/Layer/AbstractDataLayer.php
634 /src/Core/Localization/CLDR/LocaleDataLayerInterface.php
635 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/FilesystemAdapter.php
636 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AbstractAdapter.php
637 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractAdapterTrait.php
638 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractTrait.php
639 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ContractsTrait.php
640 /vendor/symfony/contracts/Cache/CacheTrait.php
641 /vendor/psr/cache/src/InvalidArgumentException.php
642 /vendor/psr/cache/src/CacheException.php
643 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemTrait.php
644 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemCommonTrait.php
645 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/DefaultMarshaller.php
646 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/MarshallerInterface.php
647 /src/Core/Localization/CLDR/DataLayer/LocaleReference.php
648 /src/Core/Localization/CLDR/Reader.php
649 /src/Core/Localization/CLDR/ReaderInterface.php
650 /src/Core/Localization/Currency/Repository.php
651 /src/Core/Localization/Currency/RepositoryInterface.php
652 /src/Core/Localization/Currency/CurrencyDataSource.php
653 /src/Core/Localization/Currency/DataSourceInterface.php
654 /src/Core/Localization/Currency/DataLayer/CurrencyCache.php
655 /src/Core/Localization/Currency/CurrencyDataLayerInterface.php
656 /src/Core/Localization/Currency/DataLayer/CurrencyDatabase.php
657 /src/Adapter/Currency/CurrencyDataProvider.php
658 /src/Core/Currency/CurrencyDataProviderInterface.php
659 /src/Adapter/LegacyContext.php
660 /src/Adapter/Tools.php
661 /src/Core/Localization/Currency/DataLayer/CurrencyReference.php
662 /src/Core/Localization/Currency/DataLayer/CurrencyInstalled.php
663 /vendor/prestashop/decimal/src/Operation/Rounding.php
664 /src/Core/Localization/Locale.php
665 /src/Core/Localization/LocaleInterface.php
666 /src/Core/Localization/Specification/Price.php
667 /src/Core/Localization/Specification/Number.php
668 /src/Core/Localization/Specification/NumberInterface.php
669 /src/Core/Localization/Specification/Factory.php
670 /src/Core/Localization/CLDR/LocaleData.php
671 /src/Core/Localization/CLDR/NumberSymbolsData.php
672 /src/Core/Localization/CLDR/CurrencyData.php
673 /src/Core/Localization/CLDR/Locale.php
674 /src/Core/Localization/CLDR/LocaleInterface.php
675 /src/Core/Localization/Specification/NumberSymbolList.php
676 /classes/Currency.php
677 /src/Core/Localization/Currency/LocalizedCurrencyId.php
678 /src/Core/Localization/Currency/CurrencyData.php
679 /src/Core/Localization/Currency/CurrencyCollection.php
680 /src/Core/Localization/Currency.php
681 /src/Core/Localization/CurrencyInterface.php
682 /src/Core/Localization/Specification/NumberCollection.php
683 /src/Core/Localization/Number/Formatter.php
684 /classes/Cart.php
685 /src/Adapter/AddressFactory.php
686 /classes/CartRule.php
687 /classes/Product.php
688 /src/Core/Domain/Product/ValueObject/RedirectType.php
689 /src/Core/Util/DateTime/DateTime.php
690 /src/Core/Domain/Product/Stock/ValueObject/OutOfStockType.php
691 /src/Core/Domain/Product/Pack/ValueObject/PackStockType.php
692 /src/Core/Domain/Product/ValueObject/ProductType.php
693 /src/Core/Domain/Product/ValueObject/Reference.php
694 /src/Core/Domain/Product/ValueObject/Ean13.php
695 /src/Core/Domain/Product/ValueObject/Isbn.php
696 /src/Core/Domain/Product/ValueObject/Upc.php
697 /src/Core/Domain/Product/ProductSettings.php
698 /src/Core/Domain/Shop/ValueObject/ShopId.php
699 /src/Core/Domain/Shop/ValueObject/ShopIdInterface.php
700 /modules/ps_emailsubscription/ps_emailsubscription.php
701 /src/Core/Module/WidgetInterface.php
702 /src/PrestaShopBundle/Translation/DomainNormalizer.php
703 /classes/Media.php
704 /modules/ps_facebook/ps_facebook.php
705 /modules/ps_facebook/translations/es.php
706 /modules/ps_metrics/vendor/prestashop/module-lib-service-container/src/DependencyInjection/ServiceContainer.php
707 /modules/ps_metrics/vendor/prestashop/module-lib-cache-directory-provider/src/Cache/CacheDirectoryProvider.php
708 /modules/ps_metrics/vendor/prestashop/module-lib-service-container/src/DependencyInjection/ContainerProvider.php
709 /var/cache/prod/Ps_facebookFrontContainer.php
710 /modules/ps_facebook/classes/Buffer/TemplateBuffer.php
711 /modules/ps_emailalerts/ps_emailalerts.php
712 /modules/ps_emailalerts/MailAlert.php
713 /src/Adapter/Presenter/Cart/CartLazyArray.php
714 /src/Adapter/Presenter/AbstractLazyArray.php
715 /src/Adapter/Product/PriceFormatter.php
716 /src/Core/Util/Inflector.php
717 /vendor/doctrine/inflector/lib/Doctrine/Inflector/InflectorFactory.php
718 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Language.php
719 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/InflectorFactory.php
720 /vendor/doctrine/inflector/lib/Doctrine/Inflector/GenericLanguageInflectorFactory.php
721 /vendor/doctrine/inflector/lib/Doctrine/Inflector/LanguageInflectorFactory.php
722 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Rules.php
723 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Ruleset.php
724 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformations.php
725 /vendor/doctrine/inflector/lib/Doctrine/Inflector/WordInflector.php
726 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Inflectible.php
727 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformation.php
728 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Pattern.php
729 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Patterns.php
730 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Uninflected.php
731 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitutions.php
732 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitution.php
733 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Word.php
734 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Inflector.php
735 /vendor/doctrine/inflector/lib/Doctrine/Inflector/CachedWordInflector.php
736 /vendor/doctrine/inflector/lib/Doctrine/Inflector/RulesetInflector.php
737 /classes/Gender.php
738 /classes/Risk.php
739 /classes/Meta.php
740 /classes/Address.php
741 /classes/ImageType.php
742 /classes/State.php
743 /src/Core/Security/PasswordPolicyConfiguration.php
744 /src/Core/Configuration/DataConfigurationInterface.php
745 /src/Core/Security/Hashing.php
746 /src/Core/Filter/FrontEndObject/MainFilter.php
747 /src/Core/Filter/FilterInterface.php
748 /src/Core/Filter/FrontEndObject/CartFilter.php
749 /src/Core/Filter/HashMapWhitelistFilter.php
750 /src/Core/Filter/CollectionFilter.php
751 /src/Core/Filter/FrontEndObject/ProductFilter.php
752 /src/Core/Filter/FrontEndObject/EmbeddedAttributesFilter.php
753 /src/Core/Filter/FrontEndObject/CustomerFilter.php
754 /src/Core/Filter/FrontEndObject/ShopFilter.php
755 /src/Core/Filter/FrontEndObject/ConfigurationFilter.php
756 /modules/productcomments/productcomments.php
757 /modules/ps_shoppingcart/ps_shoppingcart.php
758 /modules/ps_facebook/classes/Handler/ErrorHandler/ErrorHandler.php
759 /modules/ps_facebook/classes/Config/Env.php
760 /modules/ps_facebook/classes/Handler/ErrorHandler/ModuleFilteredRavenClient.php
761 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/Client.php
762 /modules/ps_facebook/classes/Config/Config.php
763 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/Util.php
764 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/Compat.php
765 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/Processor/SanitizeDataProcessor.php
766 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/Processor.php
767 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/Context.php
768 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/Breadcrumbs.php
769 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/Serializer.php
770 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/ReprSerializer.php
771 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/TransactionStack.php
772 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/Breadcrumbs/ErrorHandler.php
773 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/Stacktrace.php
774 /modules/ps_facebook/vendor/prestashop/prestashop-accounts-installer/src/Installer/Facade/PsAccounts.php
775 /modules/ps_facebook/vendor/prestashop/prestashop-accounts-installer/src/Installer/Installer.php
776 /src/Core/Addon/Module/ModuleManagerBuilder.php
777 /src/Core/Util/File/YamlParser.php
778 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/SelfCheckingResourceChecker.php
779 /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerInterface.php
780 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/FileResource.php
781 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/SelfCheckingResourceInterface.php
782 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/ResourceInterface.php
783 /var/cache/prod/yaml/b57b1d618dfd4975fcf38dbdde58e4aa.php
784 /src/Adapter/LegacyLogger.php
785 /src/PrestaShopBundle/Service/DataProvider/Admin/CategoriesProvider.php
786 /src/Adapter/Module/ModuleDataProvider.php
787 /src/Adapter/Module/AdminModuleDataProvider.php
788 /src/PrestaShopBundle/Service/DataProvider/Admin/ModuleInterface.php
789 /src/Adapter/Module/Module.php
790 /src/Core/Module/ModuleInterface.php
791 /vendor/symfony/symfony/src/Symfony/Component/Config/FileLocator.php
792 /vendor/symfony/symfony/src/Symfony/Component/Config/FileLocatorInterface.php
793 /vendor/symfony/symfony/src/Symfony/Component/Routing/Loader/YamlFileLoader.php
794 /vendor/symfony/symfony/src/Symfony/Component/Config/Loader/FileLoader.php
795 /vendor/symfony/symfony/src/Symfony/Component/Config/Loader/Loader.php
796 /vendor/symfony/symfony/src/Symfony/Component/Config/Loader/LoaderInterface.php
797 /vendor/symfony/symfony/src/Symfony/Component/Routing/Router.php
798 /vendor/symfony/symfony/src/Symfony/Component/Routing/RouterInterface.php
799 /vendor/symfony/symfony/src/Symfony/Component/Routing/Matcher/UrlMatcherInterface.php
800 /vendor/symfony/symfony/src/Symfony/Component/Routing/RequestContextAwareInterface.php
801 /vendor/symfony/symfony/src/Symfony/Component/Routing/Generator/UrlGeneratorInterface.php
802 /vendor/symfony/symfony/src/Symfony/Component/Routing/Matcher/RequestMatcherInterface.php
803 /vendor/symfony/symfony/src/Symfony/Component/Routing/RequestContext.php
804 /src/Adapter/Module/ModuleDataUpdater.php
805 /src/Core/Module/ModuleManager.php
806 /src/Core/Module/ModuleManagerInterface.php
807 /src/Core/Module/ModuleRepository.php
808 /src/Core/Module/ModuleRepositoryInterface.php
809 /src/Adapter/HookManager.php
810 /src/Core/Module/SourceHandler/SourceHandlerFactory.php
811 /src/PrestaShopBundle/Event/Dispatcher/NullDispatcher.php
812 /vendor/symfony/symfony/src/Symfony/Component/EventDispatcher/EventDispatcherInterface.php
813 /vendor/symfony/contracts/EventDispatcher/EventDispatcherInterface.php
814 /modules/ps_metrics/vendor/psr/event-dispatcher/src/EventDispatcherInterface.php
815 /src/Core/Hook/HookDispatcherInterface.php
816 /modules/ps_accounts/ps_accounts.php
817 /modules/ps_accounts/vendor/autoload.php
818 /modules/ps_accounts/vendor/composer/autoload_real.php
819 /modules/ps_accounts/vendor/composer/platform_check.php
820 /modules/ps_accounts/vendor/composer/autoload_static.php
821 /modules/ps_accounts/vendor/paragonie/random_compat/lib/random.php
822 /modules/ps_accounts/vendor/symfony/polyfill-ctype/bootstrap.php
823 /modules/ps_accounts/vendor/lcobucci/jwt/compat/class-aliases.php
824 /modules/ps_accounts/vendor/lcobucci/jwt/src/Token.php
825 /modules/ps_accounts/vendor/lcobucci/jwt/src/Signature.php
826 /modules/ps_accounts/vendor/lcobucci/jwt/compat/json-exception-polyfill.php
827 /modules/ps_accounts/vendor/lcobucci/jwt/compat/lcobucci-clock-polyfill.php
828 /modules/ps_accounts/vendor/ramsey/uuid/src/functions.php
829 /modules/ps_accounts/src/Hook/HookableTrait.php
830 /modules/ps_accounts/src/Module/Install.php
831 /modules/ps_accounts/src/Settings/SettingsForm.php
832 /modules/ps_accounts/translations/es.php
833 /modules/ps_accounts/src/ServiceContainer/PsAccountsContainer.php
834 /modules/ps_accounts/vendor/prestashopcorp/lightweight-container/src/ServiceContainer/ServiceContainer.php
835 /modules/ps_accounts/config.php
836 /modules/ps_accounts/src/Log/Logger.php
837 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Logger.php
838 /modules/ps_accounts/vendor/psr/log/Psr/Log/LoggerInterface.php
839 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/ResettableInterface.php
840 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Handler/RotatingFileHandler.php
841 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Handler/StreamHandler.php
842 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Handler/AbstractProcessingHandler.php
843 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Handler/AbstractHandler.php
844 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Handler/HandlerInterface.php
845 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Utils.php
846 /modules/ps_accounts/src/ServiceProvider/ApiClientProvider.php
847 /modules/ps_accounts/vendor/prestashopcorp/lightweight-container/src/ServiceContainer/Contract/IServiceProvider.php
848 /modules/ps_accounts/src/ServiceProvider/CommandProvider.php
849 /modules/ps_accounts/src/ServiceProvider/DefaultProvider.php
850 /modules/ps_accounts/src/ServiceProvider/OAuth2Provider.php
851 /modules/ps_accounts/src/ServiceProvider/QueryProvider.php
852 /modules/ps_accounts/src/ServiceProvider/RepositoryProvider.php
853 /modules/ps_accounts/src/ServiceProvider/SessionProvider.php
854 /modules/ps_accounts/src/Service/PsAccountsService.php
855 /modules/ps_accounts/src/Account/Session/ShopSession.php
856 /modules/ps_accounts/src/Account/Session/Session.php
857 /modules/ps_accounts/src/Account/Session/SessionInterface.php
858 /modules/ps_accounts/src/Repository/ConfigurationRepository.php
859 /modules/ps_accounts/src/Adapter/Configuration.php
860 /modules/ps_accounts/src/Service/OAuth2/OAuth2Service.php
861 /modules/ps_accounts/src/Http/Client/ClientConfig.php
862 /modules/ps_accounts/src/Http/Client/ConfigObject.php
863 /modules/ps_accounts/src/Type/Enum.php
864 /modules/ps_accounts/src/Service/OAuth2/OAuth2Client.php
865 /modules/ps_accounts/src/Adapter/Link.php
866 /modules/ps_accounts/src/Context/ShopContext.php
867 /modules/ps_accounts/vendor/ramsey/uuid/src/Uuid.php
868 /modules/ps_accounts/vendor/ramsey/uuid/src/UuidInterface.php
869 /modules/ps_accounts/vendor/ramsey/uuid/src/UuidFactory.php
870 /modules/ps_accounts/vendor/ramsey/uuid/src/UuidFactoryInterface.php
871 /modules/ps_accounts/vendor/ramsey/uuid/src/FeatureSet.php
872 /modules/ps_accounts/vendor/ramsey/uuid/src/Converter/Number/DegradedNumberConverter.php
873 /modules/ps_accounts/vendor/ramsey/uuid/src/Converter/NumberConverterInterface.php
874 /modules/ps_accounts/vendor/ramsey/uuid/src/Builder/DefaultUuidBuilder.php
875 /modules/ps_accounts/vendor/ramsey/uuid/src/Builder/UuidBuilderInterface.php
876 /modules/ps_accounts/vendor/ramsey/uuid/src/Codec/StringCodec.php
877 /modules/ps_accounts/vendor/ramsey/uuid/src/Codec/CodecInterface.php
878 /modules/ps_accounts/vendor/ramsey/uuid/src/Provider/Node/FallbackNodeProvider.php
879 /modules/ps_accounts/vendor/ramsey/uuid/src/Provider/NodeProviderInterface.php
880 /modules/ps_accounts/vendor/ramsey/uuid/src/Provider/Node/SystemNodeProvider.php
881 /modules/ps_accounts/vendor/ramsey/uuid/src/Provider/Node/RandomNodeProvider.php
882 /modules/ps_accounts/vendor/ramsey/uuid/src/Generator/RandomGeneratorFactory.php
883 /modules/ps_accounts/vendor/ramsey/uuid/src/Generator/RandomBytesGenerator.php
884 /modules/ps_accounts/vendor/ramsey/uuid/src/Generator/RandomGeneratorInterface.php
885 /modules/ps_accounts/vendor/ramsey/uuid/src/Provider/Time/SystemTimeProvider.php
886 /modules/ps_accounts/vendor/ramsey/uuid/src/Provider/TimeProviderInterface.php
887 /modules/ps_accounts/vendor/ramsey/uuid/src/Generator/TimeGeneratorFactory.php
888 /modules/ps_accounts/vendor/ramsey/uuid/src/Converter/Time/PhpTimeConverter.php
889 /modules/ps_accounts/vendor/ramsey/uuid/src/Converter/TimeConverterInterface.php
890 /modules/ps_accounts/vendor/ramsey/uuid/src/Generator/DefaultTimeGenerator.php
891 /modules/ps_accounts/vendor/ramsey/uuid/src/Generator/TimeGeneratorInterface.php
892 /modules/ps_accounts/vendor/ramsey/uuid/src/BinaryUtils.php
893 /modules/ps_accounts/src/Service/OAuth2/CachedFile.php
894 /modules/ps_accounts/src/Account/Session/Firebase/ShopSession.php
895 /modules/ps_accounts/src/Account/Session/Firebase/FirebaseSession.php
896 /modules/ps_accounts/src/Account/Session/Firebase/OwnerSession.php
897 /modules/ps_accounts/src/Account/StatusManager.php
898 /modules/ps_accounts/src/Traits/WithOriginAndSourceTrait.php
899 /modules/ps_accounts/src/Traits/WithPropertyTrait.php
900 /modules/ps_accounts/src/Service/Accounts/AccountsService.php
901 /modules/ps_accounts/src/Service/AnalyticsService.php
902 /modules/ps_accounts/src/Service/AdminTokenService.php
903 /modules/ps_accounts/src/Adapter/ConfigurationKeys.php
904 /modules/ps_accounts/src/Account/CachedShopStatus.php
905 /modules/ps_accounts/src/Http/Resource/Resource.php
906 /modules/ps_accounts/src/Type/Dto.php
907 /modules/ps_accounts/src/Service/Accounts/Resource/ShopStatus.php
908 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/ErrorHandler.php
909 /modules/ps_facebook/classes/Dispatcher/EventDispatcher.php
910 /modules/ps_facebook/classes/Handler/ApiConversionHandler.php
911 /modules/ps_facebook/classes/Adapter/ConfigurationAdapter.php
912 /modules/ps_facebook/classes/Factory/ContextFactory.php
913 /modules/ps_facebook/classes/API/Client/FacebookClient.php
914 /modules/ps_facebook/classes/Factory/FacebookEssentialsApiClientFactory.php
915 /modules/ps_facebook/classes/Factory/ApiClientFactoryInterface.php
916 /modules/ps_facebook/classes/Provider/AccessTokenProvider.php
917 /modules/ps_facebook/classes/Factory/PsApiClientFactory.php
918 /modules/ps_facebook/classes/Handler/ConfigurationHandler.php
919 /modules/ps_facebook/classes/Http/HttpClient.php
920 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Api.php
921 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Session.php
922 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/SessionInterface.php
923 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/ApiConfig.php
924 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/Client.php
925 /modules/ps_facebook/classes/Handler/PixelHandler.php
926 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/MockFileSessionStorage.php
927 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/MockArraySessionStorage.php
928 /modules/ps_facebook/classes/Provider/EventDataProvider.php
929 /modules/ps_facebook/classes/Adapter/ToolsAdapter.php
930 /modules/ps_facebook/classes/Repository/ProductRepository.php
931 /modules/ps_facebook/classes/Provider/ProductAvailabilityProvider.php
932 /modules/ps_facebook/classes/Provider/ProductAvailabilityProviderInterface.php
933 /modules/ps_facebook/classes/Repository/GoogleCategoryRepository.php
934 /modules/ps_facebook/classes/Provider/GoogleCategoryProvider.php
935 /modules/ps_facebook/classes/Provider/GoogleCategoryProviderInterface.php
936 /classes/Combination.php
937 /classes/stock/StockAvailable.php
938 /classes/tax/Tax.php
939 /vendor/prestashop/decimal/src/DecimalNumber.php
940 /vendor/prestashop/decimal/src/Builder.php
941 /classes/SpecificPrice.php
942 /classes/tax/TaxManagerFactory.php
943 /classes/tax/TaxRulesTaxManager.php
944 /classes/tax/TaxManagerInterface.php
945 /classes/tax/TaxCalculator.php
946 /classes/GroupReduction.php
947 /src/Core/Localization/CLDR/ComputingPrecision.php
948 /src/Core/Localization/CLDR/ComputingPrecisionInterface.php
949 /classes/Pack.php
950 /classes/order/Order.php
951 /classes/Feature.php
952 /modules/ps_facebook/classes/Utility/ProductCatalogUtility.php
953 /src/Core/Util/String/StringModifier.php
954 /src/Core/Util/String/StringModifierInterface.php
955 /modules/ps_facebook/classes/Utility/CustomerInformationUtility.php
956 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/ServerSide/UserData.php
957 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/ServerSide/CustomData.php
958 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/ServerSide/Event.php
959 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/ServerSide/ActionSource.php
960 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Enum/AbstractEnum.php
961 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Enum/EnumInstanceInterface.php
962 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/ServerSide/EventRequest.php
963 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/ServerSide/HttpServiceClientConfig.php
964 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/ServerSide/Singleton.php
965 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/ServerSide/Util.php
966 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/ServerSide/Normalizer.php
967 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/AdsPixel.php
968 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/AbstractCrudObject.php
969 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/AbstractObject.php
970 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/Fields/AdsPixelFields.php
971 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/TypeChecker.php
972 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/Values/AdsPixelSortByValues.php
973 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/Values/AdsPixelAutomaticMatchingFieldsValues.php
974 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/Values/AdsPixelDataUseSettingValues.php
975 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/Values/AdsPixelFirstPartyCookieStatusValues.php
976 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/Values/AdsPixelPermittedTasksValues.php
977 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/Values/AdsPixelTasksValues.php
978 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/ApiRequest.php
979 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/RequestInterface.php
980 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Enum/EmptyEnum.php
981 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/Request.php
982 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/Parameters.php
983 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Logger/NullLogger.php
984 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Logger/LoggerInterface.php
985 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/Adapter/CurlAdapter.php
986 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/Adapter/AbstractAdapter.php
987 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/Adapter/AdapterInterface.php
988 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/Adapter/Curl/AbstractCurl.php
989 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/Adapter/Curl/CurlInterface.php
990 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/Adapter/Curl/Curl55.php
991 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/Response.php
992 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/ResponseInterface.php
993 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/Headers.php
994 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/ServerSide/EventResponse.php
995 /vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php
996 /var/cache/prod/smarty/compile/warehouse/7b/d6/67/7bd6674da24c9dfe787a4ab6d9f95992772bfd39_2.file.header.tpl.php
997 /vendor/smarty/smarty/libs/plugins/modifier.escape.php
998 /var/cache/prod/smarty/compile/warehouse/e4/c2/28/e4c22868c11d8c62c1db61f765dd994d1dfa43b9_2.file.fbTrack.tpl.php
999 /modules/psxmarketingwithgoogle/psxmarketingwithgoogle.php
1000 /modules/psxmarketingwithgoogle/translations/es.php
1001 /var/cache/prod/PsxmarketingwithgoogleFrontContainer.php
1002 /modules/psxmarketingwithgoogle/classes/Adapter/ConfigurationAdapter.php
1003 /modules/psxmarketingwithgoogle/classes/Factory/ContextFactory.php
1004 /modules/psxmarketingwithgoogle/classes/config/Config.php
1005 /modules/psxmarketingwithgoogle/classes/Handler/RemarketingHookHandler.php
1006 /modules/psxmarketingwithgoogle/classes/Buffer/TemplateBuffer.php
1007 /modules/iqitcookielaw/iqitcookielaw.php
1008 /modules/iqitcookielaw/translations/es.php
1009 /modules/iqitmegamenu/iqitmegamenu.php
1010 /modules/iqitmegamenu/models/IqitMenuTab.php
1011 /modules/iqitmegamenu/models/IqitMenuHtml.php
1012 /modules/iqitmegamenu/models/IqitMenuLinks.php
1013 /modules/iqitmegamenu/translations/es.php
1014 /modules/iqitelementor/iqitelementor.php
1015 /modules/iqitelementor/src/IqitElementorLanding.php
1016 /modules/iqitelementor/src/IqitElementorTemplate.php
1017 /modules/iqitelementor/src/IqitElementorProduct.php
1018 /modules/iqitelementor/src/IqitElementorCategory.php
1019 /modules/iqitelementor/src/IqitElementorContent.php
1020 /modules/iqitelementor/src/iqitElementorWpHelper.php
1021 /modules/iqitelementor/includes/plugin-elementor.php
1022 /modules/iqitelementor/src/widgets/IqitElementorWidget_Brands.php
1023 /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsList.php
1024 /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsListTabs.php
1025 /modules/iqitelementor/src/widgets/IqitElementorWidget_Modules.php
1026 /modules/iqitelementor/src/widgets/IqitElementorWidget_CustomTpl.php
1027 /modules/iqitelementor/src/widgets/IqitElementorWidget_Menu.php
1028 /modules/iqitelementor/src/widgets/IqitElementorWidget_RevolutionSlider.php
1029 /modules/iqitelementor/src/widgets/IqitElementorWidget_Newsletter.php
1030 /modules/iqitelementor/src/widgets/IqitElementorWidget_Blog.php
1031 /modules/iqitelementor/src/widgets/IqitElementorWidget_Search.php
1032 /modules/iqitelementor/src/widgets/IqitElementorWidget_Links.php
1033 /modules/iqitelementor/src/widgets/IqitElementorWidget_ContactForm.php
1034 /modules/iqitelementor/translations/es.php
1035 /modules/nacex/nacex.php
1036 /modules/nacex/nacexWS.php
1037 /modules/nacex/nacexDTO.php
1038 /modules/nacex/AdminConfig.php
1039 /modules/nacex/UserGuide.php
1040 /modules/nacex/VInewServices.php
1041 /modules/nacex/nacexutils.php
1042 /modules/nacex/LBnewService.php
1043 /modules/nacex/nacexDAO.php
1044 /modules/nacex/ROnacexshop.php
1045 /modules/nacex/tratardatos.php
1046 /modules/nacex/nacexVIEW.php
1047 /modules/nacex/hash.php
1048 /classes/module/CarrierModule.php
1049 /modules/nacex/translations/es.php
1050 /src/Core/Product/Search/ProductSearchContext.php
1051 /src/Core/Product/Search/ProductSearchQuery.php
1052 /src/Core/Product/Search/SortOrder.php
1053 /modules/ps_facetedsearch/ps_facetedsearch.php
1054 /modules/ps_facetedsearch/src/HookDispatcher.php
1055 /modules/ps_facetedsearch/src/Hook/Attribute.php
1056 /modules/ps_facetedsearch/src/Hook/AbstractHook.php
1057 /modules/ps_facetedsearch/src/Hook/AttributeGroup.php
1058 /modules/ps_facetedsearch/src/Hook/Category.php
1059 /modules/ps_facetedsearch/src/Hook/Configuration.php
1060 /modules/ps_facetedsearch/src/Hook/Design.php
1061 /modules/ps_facetedsearch/src/Hook/Feature.php
1062 /modules/ps_facetedsearch/src/Form/Feature/FormModifier.php
1063 /modules/ps_facetedsearch/src/Form/Feature/FormDataProvider.php
1064 /modules/ps_facetedsearch/src/Hook/FeatureValue.php
1065 /modules/ps_facetedsearch/src/Form/FeatureValue/FormModifier.php
1066 /modules/ps_facetedsearch/src/Form/FeatureValue/FormDataProvider.php
1067 /modules/ps_facetedsearch/src/Hook/Product.php
1068 /modules/ps_facetedsearch/src/Hook/ProductSearch.php
1069 /modules/ps_facetedsearch/src/Hook/SpecificPrice.php
1070 /modules/ps_facetedsearch/src/Filters/Provider.php
1071 /modules/ps_facetedsearch/src/URLSerializer.php
1072 /modules/ps_facetedsearch/src/Filters/DataAccessor.php
1073 /modules/ps_facetedsearch/src/Product/SearchProvider.php
1074 /src/Core/Product/Search/FacetsRendererInterface.php
1075 /src/Core/Product/Search/ProductSearchProviderInterface.php
1076 /modules/ps_facetedsearch/src/Filters/Converter.php
1077 /modules/ps_facetedsearch/src/Product/SearchFactory.php
1078 /src/Core/Product/Search/ProductSearchResult.php
1079 /modules/ps_facetedsearch/src/Product/Search.php
1080 /modules/ps_facetedsearch/src/Adapter/MySQL.php
1081 /modules/ps_facetedsearch/src/Adapter/AbstractAdapter.php
1082 /modules/ps_facetedsearch/src/Adapter/InterfaceAdapter.php
1083 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ArrayCollection.php
1084 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Collection.php
1085 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ReadableCollection.php
1086 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Selectable.php
1087 /modules/ps_facetedsearch/src/Filters/Products.php
1088 /modules/ps_facetedsearch/src/Filters/Block.php
1089 /src/Core/Product/Search/Facet.php
1090 /src/Core/Product/Search/Filter.php
1091 /src/Core/Product/Search/FacetCollection.php
1092 /classes/ProductAssembler.php
1093 /classes/Manufacturer.php
1094 /classes/ProductPresenterFactory.php
1095 /src/Adapter/Presenter/Product/ProductListingPresenter.php
1096 /src/Adapter/Presenter/Product/ProductPresenter.php
1097 /src/Adapter/Product/ProductColorsRetriever.php
1098 /src/Core/Product/ProductPresentationSettings.php
1099 /src/Adapter/Presenter/Product/ProductListingLazyArray.php
1100 /src/Adapter/Presenter/Product/ProductLazyArray.php
1101 /classes/Image.php
1102 /src/Core/Image/ImageFormatConfiguration.php
1103 /src/Core/Image/ImageFormatConfigurationInterface.php
1104 /classes/FeatureFlag.php
1105 /src/Core/FeatureFlag/FeatureFlagSettings.php
1106 /var/cache/prod/smarty/compile/warehouse/d4/1d/65/d41d65d76b9471b5d365fe06cf1737c89a53af9f_2.module.ps_facetedsearchviewstemplatesfrontcatalogfacets.tpl.php
1107 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_block.php
1108 /vendor/smarty/smarty/libs/plugins/modifier.count.php
1109 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php
1110 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_foreach.php
1111 /var/cache/prod/smarty/compile/warehouse/2e/80/73/2e807335546cfa2360c36327ac89dd2fcb054379_2.module.ps_facetedsearchviewstemplatesfrontcatalogactivefilters.tpl.php
1112 /src/Core/Product/Search/Pagination.php
1113 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/75/a6/42/75a64202e97931196bc7ffc62f78ffd65260f53c_2.file.category.tpl.php
1114 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_capture.php
1115 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/94/12/cc/9412ccef9680927153b45c6ae144d544996206b6_2.file.product-list.tpl.php
1116 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/b9/42/2f/b9422fde64d87165f5f5c624a4cbefbe5f5cc591_2.file.layout-left-column.tpl.php
1117 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/d2/95/d8/d295d85097e23dfc619a6d9948f9bb0871953825_2.file.layout-both-columns.tpl.php
1118 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/48/f1/3f/48f13f505ce53fe1a91e5a59ff252495434ac43d_2.file.helpers.tpl.php
1119 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_tplfunction.php
1120 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/1b/22/bc/1b22bcae0a59cc6b48cc1c9c25235f501651e518_2.file.head.tpl.php
1121 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/41/92/2e/41922ed228227013af99527db113ad08c91d4c9b_2.file.head-jsonld.tpl.php
1122 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/e2/41/5c/e2415c4af2ebd285942a955984af4b4e1aa22189_2.file.product-list-jsonld.tpl.php
1123 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/04/1b/47/041b4759bcd23a9de0adfa67f3a43b8b64636a07_2.file.pagination-seo.tpl.php
1124 /vendor/smarty/smarty/libs/plugins/modifier.replace.php
1125 /vendor/smarty/smarty/libs/plugins/shared.mb_str_replace.php
1126 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/43/32/e4/4332e4a9374e52ec03407d255e0717700fe0ae38_2.file.stylesheets.tpl.php
1127 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/ad/11/eb/ad11ebbbe1d132c2eb222c363cd04b3dee98d8fb_2.file.javascript.tpl.php
1128 /classes/ProductDownload.php
1129 /src/Core/Cart/Calculator.php
1130 /src/Core/Cart/CartRowCollection.php
1131 /src/Core/Cart/Fees.php
1132 /src/Core/Cart/AmountImmutable.php
1133 /src/Core/Cart/CartRuleCollection.php
1134 /src/Core/Cart/CartRuleCalculator.php
1135 /src/Adapter/Product/PriceCalculator.php
1136 /src/Core/Cart/CartRow.php
1137 /vendor/symfony/symfony/src/Symfony/Component/Translation/PluralizationRules.php
1138 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/b3/9c/46/b39c46fe99acdbe1574e9b876a398a0024152c16_2.file.product-activation.tpl.php
1139 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/da/79/cf/da79cf6aab6675d177369043b59a83d42869b4f0_2.file.header.tpl.php
1140 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/6a/a2/df/6aa2dfd27b196571f30e719112e04b70f089f033_2.file.social-links.tpl.php
1141 /modules/iqitlinksmanager/iqitlinksmanager.php
1142 /modules/iqitlinksmanager/src/IqitLinkBlockRepository.php
1143 /modules/iqitlinksmanager/src/IqitLinkBlock.php
1144 /modules/iqitlinksmanager/src/IqitLinkBlockPresenter.php
1145 /modules/iqitlinksmanager/translations/es.php
1146 /vendor/smarty/smarty/libs/sysplugins/smarty_template_cached.php
1147 /vendor/smarty/smarty/libs/sysplugins/smarty_cacheresource.php
1148 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_cacheresource_file.php
1149 /var/cache/prod/smarty/cache/iqitlinksmanager/1/1/1/6/displayNav1/warehouse/00/9f/22/009f22a54fda4ac75973e63c46f0132b1119ba03.iqitlinksmanagerviewstemplateshookiqitlinksmanager.tpl.php
1150 /modules/ps_languageselector/ps_languageselector.php
1151 /modules/ps_currencyselector/ps_currencyselector.php
1152 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/08/d5/04/08d504d7a022befca93803f3e17505b861ca8248_2.file.header-3.tpl.php
1153 /modules/iqitsearch/iqitsearch.php
1154 /modules/iqitsearch/translations/es.php
1155 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_gettemplatevars.php
1156 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/d9/9b/94/d99b947421dcff226f28b1d6cb674c91f17399db_2.module.iqitsearchviewstemplateshookiqitsearchbtn.tpl.php
1157 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/46/29/db/4629dbb3c4efa13c090c633dc2e46e5f2b42bed3_2.module.iqitsearchviewstemplateshooksearchbar.tpl.php
1158 /modules/ps_customersignin/ps_customersignin.php
1159 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/72/be/19/72be192e406191c1cad554abe284e159adeb4234_2.module.ps_customersigninps_customersigninbtn.tpl.php
1160 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/b4/a4/76/b4a476e0a8201677b298f7c0f8ca1ac698e1bac3_2.module.ps_shoppingcartps_shoppingcartbtn.tpl.php
1161 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/35/65/5e/35655e6409b6198f29dd6e732ef9598dec599880_2.module.ps_shoppingcartps_shoppingcart.tpl.php
1162 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/f6/e9/f2/f6e9f2b1680a466582d2199d038efe2cfa3a83f7_2.module.ps_shoppingcartps_shoppingcartcontent.tpl.php
1163 /var/cache/prod/smarty/cache/iqitmegamenu/index/1/1/1/6/warehouse/0e/3d/e6/0e3de6994bee6e3198146e208ce6beab444c9b4c.iqitmegamenuviewstemplateshookhorizontal.tpl.php
1164 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/cc/19/65/cc196527306127f5e0d92c634bf0405f2119a661_2.file.mobile-header-2.tpl.php
1165 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/7a/30/38/7a3038780284d52e9fcd7a66e51e5b86a166106b_2.module.iqitsearchviewstemplateshooksearchbarmobile.tpl.php
1166 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/be/ee/e6/beeee6f3d87613010f8af1cabc4c4562f8cf600a_2.module.ps_customersigninps_customersigninmobile.tpl.php
1167 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/d4/e1/57/d4e1571b6b210795247564db06deb17061778b51_2.module.ps_shoppingcartps_shoppingcartmqty.tpl.php
1168 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/90/d8/0a/90d80a9022c08011c7d753c6c3e409a4ae5b7fda_2.file.breadcrumb.tpl.php
1169 /modules/iqitproductsnav/iqitproductsnav.php
1170 /modules/iqitproductsnav/translations/es.php
1171 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/19/19/82/191982fa1e9d343688d9b381fea21c314a7ebef3_2.file.notifications.tpl.php
1172 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/3f/08/79/3f087969496cb1217bbe01ca6f95bbcaae18b1cf_2.file.category-header.tpl.php
1173 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/3e/fc/5c/3efc5c6cabf68a518dde9956926db6cf60a93dd5_2.file.products-top.tpl.php
1174 /vendor/smarty/smarty/libs/plugins/modifier.regex_replace.php
1175 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/5e/be/46/5ebe46ba384c4e31c6497e544847aec50e2df7ed_2.file.sort-orders.tpl.php
1176 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/df/95/52/df9552fec00c67a219e4d30c27efc6f3e649e435_2.file.products.tpl.php
1177 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/55/7a/be/557abe380aacf1dcc82a9614401a41c90059c373_2.file.product.tpl.php
1178 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/83/21/1d/83211d3e18c7848aecc64c18474f33bc0ea7cd65_2.file.product-miniature-1.tpl.php
1179 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/0a/d6/ba/0ad6ba9370f144df31a3308c307c61383af0f46f_2.file.product-miniature-thumb.tpl.php
1180 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/54/f1/31/54f131cbfede74c5ff970f4d07b4366036e2f8db_2.file.product-miniature-btn.tpl.php
1181 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/c2/18/5e/c2185e235e559bf004db69cd2c6a7703df41adb0_2.file.pagination.tpl.php
1182 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/5e/fc/91/5efc91d7387e3670df18e3cf6645652c4546f7c9_2.file.products-bottom.tpl.php
1183 /var/cache/prod/smarty/compile/warehouse/81/a1/04/81a1040ed0eeab6f58198f9907167c7fced628c5_2.module.ps_facetedsearchps_facetedsearch.tpl.php
1184 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/36/7c/da/367cdad5e95c9d0937b2526e141cbe7cc11d72f9_2.file.footer.tpl.php
1185 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/2c/ca/be/2ccabe66f524058310a6818abce4e6d56ee1bb64_2.file.footer-1.tpl.php
1186 /var/cache/prod/smarty/cache/iqitlinksmanager/1/1/1/6/displayFooter/warehouse/00/9f/22/009f22a54fda4ac75973e63c46f0132b1119ba03.iqitlinksmanagerviewstemplateshookiqitlinksmanager.tpl.php
1187 /modules/corewhatsapp/corewhatsapp.php
1188 /modules/corewhatsapp/classes/Corewhatsapp.php
1189 /var/cache/prod/smarty/compile/warehouse/f3/d9/ed/f3d9ed074127cff4b22b15d975f7cd788fe3a35d_2.file.corewhatsapp.tpl.php
1190 /var/cache/prod/smarty/compile/warehouse/30/7d/c6/307dc6bd4724d29d1572cc301dd7148e962604ef_2.module.ps_emailsubscriptionviewstemplateshookps_emailsubscription.tpl.php
1191 /modules/psgdpr/psgdpr.php
1192 /modules/psgdpr/translations/es.php
1193 /modules/psgdpr/classes/GDPRConsent.php
1194 /var/cache/prod/smarty/compile/warehouse/5e/ee/24/5eee242e5cbca9bb89b8ffa439cebef7beaaf2e4_2.module.psgdprviewstemplateshookdisplayGDPRConsent.tpl.php
1195 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/94/7d/69/947d69d2647da7c0eeb75ef9497030be726dc5dc_2.file.footer-copyrights-1.tpl.php
1196 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/ef/d8/5e/efd85eed67e0be9a97e7376c50dacb5344f76046_2.file.password-policy-template.tpl.php
1197 /var/cache/prod/smarty/cache/iqitcookielaw/1/1/1/6/warehouse/e7/7b/d0/e77bd029c1dc3735e3f4798f608cdf3e90a317c6.iqitcookielawviewstemplateshookiqitcookielaw.tpl.php
1198 /modules/statsdata/statsdata.php
1199 /classes/Connection.php
1200 /classes/ConnectionsSource.php