Inicio

Utilizamos cookies propias y de terceros para mejorar nuestros servicios y mostrarle publicidad

relacionada con sus preferencias mediante el análisis de sus hábitos de navegación. Puede

consultar nuestra Política de cookies  aquí

Load Time 3227 ms
Querying Time 2051 ms
Queries 872
Memory Peak Usage 26.8 Mb
Included Files 1202 files - 11.79 Mb
PrestaShop Cache - Mb
Global vars 0.25 Mb
PrestaShop Version 8.2.4
PHP Version 8.2.30
MySQL Version 10.3.39-MariaDB
Memory Limit 524M
Max Execution Time 120s
Smarty Cache enabled
Smarty Compilation never recompile
  Time Cumulated Time Memory Usage Memory Peak Usage
config 223.505 ms 223.505 ms 2.97 Mb 3.0 Mb
__construct 1.700 ms 225.205 ms - Mb 3.5 Mb
init 112.373 ms 337.578 ms 1.29 Mb 4.3 Mb
checkAccess 0.002 ms 337.580 ms - Mb 4.3 Mb
setMedia 2.910 ms 340.490 ms 0.12 Mb 4.4 Mb
postProcess 0.002 ms 340.492 ms - Mb 4.4 Mb
initHeader 0.002 ms 340.494 ms - Mb 4.4 Mb
initContent 2476 ms 2816 ms 16.21 Mb 20.7 Mb
initFooter 0.003 ms 2816 ms - Mb 20.7 Mb
display 411.069 ms 3227 ms 5.44 Mb 26.8 Mb
Hook Time Memory Usage
DisplayHeader 1310 ms 4.91 Mb
DisplayBeforeBodyClosingTag 43.232 ms 0.31 Mb
DisplayFooter 34.499 ms 0.06 Mb
displayNav1 15.126 ms 0.14 Mb
displayNav2 6.572 ms 0.08 Mb
displayFooter 6.325 ms 0.41 Mb
displayMainMenu 5.368 ms 0.17 Mb
ProductSearchProvider 2.326 ms 0.18 Mb
DisplayGDPRConsent 1.774 ms 0.11 Mb
displayBeforeBodyClosingTag 1.276 ms 0.05 Mb
IsJustElementor 0.822 ms 0.02 Mb
DisplayLeftColumn 0.553 ms 0.12 Mb
ActionFrontControllerSetMedia 0.536 ms 0.01 Mb
displayVerticalMenu 0.012 ms - Mb
ActionDispatcher 0.011 ms - Mb
ActionProductSearchAfter 0.008 ms - Mb
Header 0.006 ms - Mb
17 hook(s) 1428 ms 6.56 Mb
Module Time Memory Usage
iqitthemeeditor 4.042 ms 0.12 Mb
ps_emailsubscription 6.273 ms 0.42 Mb
ps_facebook 1260 ms 4.74 Mb
ps_emailalerts 0.255 ms 0.04 Mb
productcomments 0.353 ms 0.03 Mb
ps_shoppingcart 0.155 ms 0.02 Mb
ps_accounts 3.772 ms 0.03 Mb
psxmarketingwithgoogle 2.357 ms 0.17 Mb
iqitcookielaw 2.336 ms 0.12 Mb
iqitmegamenu 11.457 ms 1.01 Mb
iqitelementor 55.383 ms 1.01 Mb
nacex 26.074 ms 2.03 Mb
ps_facetedsearch 7.143 ms 0.79 Mb
iqitlinksmanager 17.805 ms 0.30 Mb
ps_languageselector 5.453 ms 0.07 Mb
ps_currencyselector 1.944 ms 0.07 Mb
iqitsearch 18.103 ms 0.04 Mb
ps_customersignin 0.324 ms 0.04 Mb
corewhatsapp 35.255 ms 0.12 Mb
psgdpr 4.309 ms 0.32 Mb
statsdata 43.342 ms 0.33 Mb
21 module(s) 1506 ms 11.82 Mb

Stopwatch SQL - 872 queries

# Query Time (ms) Rows Filesort Group By Location
409 
SELECT SQL_NO_CACHE cp.id_category, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' GROUP BY p.id_product) p INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE cg.id_group='1' AND c.nleft>2 AND c.nright<197 GROUP BY cp.id_category
 310.035 ms 25664356 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
79 
SELECT SQL_NO_CACHE p.*, product_shop.*, stock.out_of_stock, IFNULL(stock.quantity, 0) AS quantity, IFNULL(product_attribute_shop.id_product_attribute, 0) AS id_product_attribute,
product_attribute_shop.minimal_quantity AS product_attribute_minimal_quantity, pl.`description`, pl.`description_short`, pl.`available_now`,
pl.`available_later`, pl.`link_rewrite`, pl.`meta_description`, pl.`meta_keywords`, pl.`meta_title`, pl.`name`, image_shop.`id_image` id_image,
il.`legend` as legend, m.`name` AS manufacturer_name, cl.`name` AS category_default,
DATEDIFF(product_shop.`date_add`, DATE_SUB("2026-04-13 00:00:00",
INTERVAL 30 DAY)) > 0 AS new, product_shop.price AS orderprice
FROM `prstshp_category_product` cp
LEFT JOIN `prstshp_product` p
ON p.`id_product` = cp.`id_product`
INNER JOIN prstshp_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1) LEFT JOIN `prstshp_product_attribute_shop` product_attribute_shop
ON (p.`id_product` = product_attribute_shop.`id_product` AND product_attribute_shop.`default_on` = 1 AND product_attribute_shop.id_shop=1)
LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `p`.id_product AND stock.id_product_attribute = 0 AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `prstshp_category_lang` cl
ON (product_shop.`id_category_default` = cl.`id_category`
AND cl.`id_lang` = 2 AND cl.id_shop = 1 )
LEFT JOIN `prstshp_product_lang` pl
ON (p.`id_product` = pl.`id_product`
AND pl.`id_lang` = 2 AND pl.id_shop = 1 )
LEFT JOIN `prstshp_image_shop` image_shop
ON (image_shop.`id_product` = p.`id_product` AND image_shop.cover=1 AND image_shop.id_shop=1)
LEFT JOIN `prstshp_image_lang` il
ON (image_shop.`id_image` = il.`id_image`
AND il.`id_lang` = 2)
LEFT JOIN `prstshp_manufacturer` m
ON m.`id_manufacturer` = p.`id_manufacturer`
WHERE product_shop.`id_shop` = 1
AND cp.`id_category` = 2 AND product_shop.`active` = 1 AND product_shop.`visibility` IN ("both", "catalog") ORDER BY cp.`position` ASC
LIMIT 360,24
 251.171 ms 5254 Yes /classes/Category.php:1062
405 
SELECT SQL_NO_CACHE p.id_product FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND cp.id_category IN (15, 18, 70, 115, 112, 113) GROUP BY p.id_product) p GROUP BY p.id_product ORDER BY p.date_add DESC, p.id_product DESC
 175.135 ms 10240000 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
75 
SELECT SQL_NO_CACHE value FROM `prstshp_configuration` WHERE `name` = "PS_MULTISHOP_FEATURE_ACTIVE" LIMIT 1
 46.158 ms 1 /modules/ps_accounts/src/Adapter/Configuration.php:278
407 
SELECT SQL_NO_CACHE psi.price_min, MIN(price_min) as min, MAX(price_max) as max FROM prstshp_product p INNER JOIN prstshp_layered_price_index psi ON (psi.id_product = p.id_product AND psi.id_shop = 1 AND psi.id_currency = 2 AND psi.id_country = 6) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND cp.id_category IN (15, 18, 70, 115, 112, 113)
 39.982 ms 3200 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
80 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 948
AND image_shop.`cover` = 1 LIMIT 1
 35.980 ms 1 /classes/Product.php:3570
857 
SELECT SQL_NO_CACHE * FROM prstshp_corewhatsapp WHERE core_status=1 AND FIND_IN_SET('2', `core_language`)  LIMIT 0,1
 33.152 ms 1 /modules/corewhatsapp/corewhatsapp.php:169
408 
SELECT SQL_NO_CACHE c.`id_category`, cl.`name`
FROM `prstshp_category` c
INNER JOIN prstshp_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `prstshp_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
WHERE 1  AND `id_lang` = 2
AND c.`active` = 1
ORDER BY c.nleft, c.position
 29.113 ms 97 Yes /classes/Category.php:710
10 
SELECT SQL_NO_CACHE domain, domain_ssl
FROM prstshp_shop_url
WHERE main = 1
AND id_shop = 1 LIMIT 1
 26.776 ms 1 /classes/shop/ShopUrl.php:178
870 
INSERT INTO `prstshp_connections_source` (`id_connections`, `http_referer`, `request_uri`, `keywords`, `date_add`) VALUES ('1363', '', 'www.joieriaorfi.es/2-inicio?page=16&q=Categor%C3%ADas-JOYAS+DE+ORO-JOYAS+DE+PLATA-JOYAS+PERSONALIZADAS+ORO-LATON-PENDIENTES+PLATA-PENJOLL-AROS', '', '2026-04-13 13:03:00')
 26.112 ms 1 /classes/ObjectModel.php:622
257 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 991
ORDER BY f.position ASC
 25.197 ms 1 Yes /classes/Product.php:6024
802 
SELECT SQL_NO_CACHE 1 FROM prstshp_cart_product cp INNER JOIN prstshp_product p
ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps
ON (ps.id_shop = cp.id_shop AND ps.id_product = p.id_product) WHERE cp.id_cart=0 LIMIT 1
 23.441 ms 1 /classes/Cart.php:4250
812 
SELECT SQL_NO_CACHE SUM(`quantity`)
FROM `prstshp_cart_product`
WHERE `id_cart` = 0 LIMIT 1
 23.088 ms 1 /classes/Cart.php:1300
815 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4464) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
 22.423 ms 1 Yes /classes/Product.php:4513
21 
SELECT SQL_NO_CACHE * FROM `prstshp_currency` c ORDER BY `iso_code` ASC
 18.130 ms 2 Yes /classes/Currency.php:708
729 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 4464
ORDER BY `position`
 15.036 ms 1 Yes /classes/Product.php:3539
561 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 4419
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 15.033 ms 0 /classes/SpecificPrice.php:256
58 
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 113) AND (b.`id_shop` = 1) LIMIT 1
 13.590 ms 1 /src/Adapter/EntityMapper.php:71
410 
REPLACE INTO prstshp_layered_filter_block (hash, data) VALUES ("9ddd1ed134d72631863f43468c8e4bce", "a:1:{s:7:\"filters\";a:2:{i:0;a:12:{s:9:\"type_lite\";s:5:\"price\";s:4:\"type\";s:5:\"price\";s:6:\"id_key\";i:0;s:4:\"name\";s:6:\"Precio\";s:3:\"max\";d:29855;s:3:\"min\";d:0;s:4:\"unit\";s:3:\"€\";s:14:\"specifications\";a:11:{s:6:\"symbol\";a:11:{i:0;s:1:\",\";i:1;s:1:\".\";i:2;s:1:\";\";i:3;s:1:\"%\";i:4;s:1:\"-\";i:5;s:1:\"+\";i:6;s:1:\"E\";i:7;s:2:\"×\";i:8;s:3:\"‰\";i:9;s:3:\"∞\";i:10;s:3:\"NaN\";}s:12:\"currencyCode\";s:3:\"EUR\";s:14:\"currencySymbol\";s:3:\"€\";s:13:\"numberSymbols\";a:11:{i:0;s:1:\",\";i:1;s:1:\".\";i:2;s:1:\";\";i:3;s:1:\"%\";i:4;s:1:\"-\";i:5;s:1:\"+\";i:6;s:1:\"E\";i:7;s:2:\"×\";i:8;s:3:\"‰\";i:9;s:3:\"∞\";i:10;s:3:\"NaN\";}s:15:\"positivePattern\";s:12:\"#,##0.00 ¤\";s:15:\"negativePattern\";s:13:\"-#,##0.00 ¤\";s:17:\"maxFractionDigits\";i:2;s:17:\"minFractionDigits\";i:2;s:12:\"groupingUsed\";b:1;s:16:\"primaryGroupSize\";i:3;s:18:\"secondaryGroupSize\";i:3;}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:3;s:3:\"nbr\";i:1484;s:5:\"value\";N;}i:1;a:7:{s:9:\"type_lite\";s:8:\"category\";s:4:\"type\";s:8:\"category\";s:6:\"id_key\";i:0;s:4:\"name\";s:11:\"Categorías\";s:6:\"values\";a:76:{i:14;a:2:{s:4:\"name\";s:7:\"RELOJES\";s:3:\"nbr\";s:3:\"374\";}i:15;a:3:{s:4:\"name\";s:12:\"JOYAS DE ORO\";s:3:\"nbr\";s:3:\"404\";s:7:\"checked\";b:1;}i:16;a:2:{s:4:\"name\";s:9:\"ORO DE 9K\";s:3:\"nbr\";s:3:\"100\";}i:17;a:2:{s:4:\"name\";s:5:\"ACERO\";s:3:\"nbr\";s:3:\"269\";}i:18;a:3:{s:4:\"name\";s:14:\"JOYAS DE PLATA\";s:3:\"nbr\";s:4:\"1075\";s:7:\"checked\";b:1;}i:19;a:2:{s:4:\"name\";s:6:\"BRONCE\";s:3:\"nbr\";s:1:\"5\";}i:20;a:2:{s:4:\"name\";s:11:\"SMART WATCH\";s:3:\"nbr\";s:2:\"16\";}i:21;a:2:{s:4:\"name\";s:18:\"RELOJES INFANTILES\";s:3:\"nbr\";s:2:\"22\";}i:23;a:2:{s:4:\"name\";s:14:\"RELOJES SEÑOR\";s:3:\"nbr\";s:3:\"178\";}i:24;a:2:{s:4:\"name\";s:15:\"RELOJES SEÑORA\";s:3:\"nbr\";s:3:\"151\";}i:25;a:2:{s:4:\"name\";s:23:\"RELOJES NIÑA COMUNIÓN\";s:3:\"nbr\";s:1:\"4\";}i:26;a:2:{s:4:\"name\";s:23:\"RELOJES NIÑO COMUNIÓN\";s:3:\"nbr\";s:1:\"3\";}i:27;a:2:{s:4:\"name\";s:16:\"COLGANTES DE ORO\";s:3:\"nbr\";s:2:\"46\";}i:28;a:2:{s:4:\"name\";s:15:\"PULSERAS DE ORO\";s:3:\"nbr\";s:2:\"34\";}i:29;a:2:{s:4:\"name\";s:17:\"PULSERA  BEBE ORO\";s:3:\"nbr\";s:1:\"3\";}i:31;a:2:{s:4:\"name\";s:14:\"PENDIENTES ORO\";s:3:\"nbr\";s:2:\"55\";}i:32;a:2:{s:4:\"name\";s:15:\"PIERCING DE ORO\";s:3:\"nbr\";s:2:\"14\";}i:33;a:2:{s:4:\"name\";s:20:\"PENDIENTES BEBÉ ORO\";s:3:\"nbr\";s:2:\"40\";}i:34;a:2:{s:4:\"name\";s:14:\"ANILLOS DE ORO\";s:3:\"nbr\";s:3:\"127\";}i:35;a:2:{s:4:\"name\";s:19:\"GARGANTILLAS DE ORO\";s:3:\"nbr\";s:2:\"40\";}i:36;a:2:{s:4:\"name\";s:17:\"PULSERA DE ORO 9K\";s:3:\"nbr\";s:2:\"21\";}i:37;a:2:{s:4:\"name\";s:13:\"ANILLO ORO 9K\";s:3:\"nbr\";s:2:\"19\";}i:38;a:2:{s:4:\"name\";s:17:\"PENDIENTES ORO 9K\";s:3:\"nbr\";s:2:\"30\";}i:39;a:2:{s:4:\"name\";s:21:\"GARGANTILLA ORO DE 9K\";s:3:\"nbr\";s:2:\"29\";}i:41;a:2:{s:4:\"name\";s:13:\"ANILLOS ACERO\";s:3:\"nbr\";s:2:\"34\";}i:42;a:2:{s:4:\"name\";s:17:\"PULSERA DE ACERO \";s:3:\"nbr\";s:3:\"129\";}i:43;a:2:{s:4:\"name\";s:16:\"PENDIENTES ACERO\";s:3:\"nbr\";s:2:\"54\";}i:44;a:2:{s:4:\"name\";s:18:\"GARGANTILLA ACERO \";s:3:\"nbr\";s:2:\"30\";}i:45;a:2:{s:4:\"name\";s:7:\"LLAVERO\";s:3:\"nbr\";s:1:\"9\";}i:46;a:2:{s:4:\"name\";s:9:\"TOBILLERA\";s:3:\"nbr\";s:2:\"13\";}i:47;a:2:{s:4:\"name\";s:26:\"JOYAS PERSONALIZADAS PLATA\";s:3:\"nbr\";s:2:\"16\";}i:48;a:2:{s:4:\"name\";s:19:\"COLECCIÓN INFANTIL\";s:3:\"nbr\";s:2:\"29\";}i:49;a:2:{s:4:\"name\";s:13:\"PULSERA PLATA\";s:3:\"nbr\";s:3:\"157\";}i:50;a:2:{s:4:\"name\";s:13:\"ANILLOS PLATA\";s:3:\"nbr\";s:3:\"188\";}i:51;a:2:{s:4:\"name\";s:16:\"PENDIENTES PLATA\";s:3:\"nbr\";s:3:\"356\";}i:52;a:2:{s:4:\"name\";s:4:\"AROS\";s:3:\"nbr\";s:1:\"6\";}i:53;a:2:{s:4:\"name\";s:8:\"PIERCING\";s:3:\"nbr\";s:2:\"25\";}i:54;a:2:{s:4:\"name\";s:22:\"PENDIENTES BEBÉ PLATA\";s:3:\"nbr\";s:2:\"11\";}i:55;a:2:{s:4:\"name\";s:17:\"GARGANTILLA PLATA\";s:3:\"nbr\";s:3:\"205\";}i:56;a:2:{s:4:\"name\";s:22:\"GARGANTILLAS INICIALES\";s:3:\"nbr\";s:1:\"4\";}i:57;a:2:{s:4:\"name\";s:6:\"CHOKER\";s:3:\"nbr\";s:1:\"1\";}i:59;a:2:{s:4:\"name\";s:10:\"JOYAS MAMA\";s:3:\"nbr\";s:2:\"31\";}i:61;a:2:{s:4:\"name\";s:8:\"EAR CUFF\";s:3:\"nbr\";s:1:\"5\";}i:62;a:2:{s:4:\"name\";s:22:\"PULSERA ACERO COMUNION\";s:3:\"nbr\";s:1:\"1\";}i:63;a:2:{s:4:\"name\";s:18:\"LLAMADOR DE ÁNGEL\";s:3:\"nbr\";s:1:\"3\";}i:64;a:2:{s:4:\"name\";s:14:\"COLGANTE PLATA\";s:3:\"nbr\";s:2:\"15\";}i:66;a:2:{s:4:\"name\";s:24:\"DETALLES PARA PROFESORES\";s:3:\"nbr\";s:2:\"21\";}i:68;a:2:{s:4:\"name\";s:17:\"COLECCIÓN LORENA\";s:3:\"nbr\";s:1:\"8\";}i:70;a:3:{s:4:\"name\";s:24:\"JOYAS PERSONALIZADAS ORO\";s:3:\"nbr\";s:1:\"4\";s:7:\"checked\";b:1;}i:74;a:2:{s:4:\"name\";s:7:\"AROS 9K\";s:3:\"nbr\";s:1:\"1\";}i:79;a:2:{s:4:\"name\";s:13:\"RELOJ SEÑORA\";s:3:\"nbr\";s:1:\"1\";}i:80;a:2:{s:4:\"name\";s:15:\"RELOJES SEÑORA\";s:3:\"nbr\";s:1:\"1\";}i:86;a:2:{s:4:\"name\";s:9:\"COMUNIÓN\";s:3:\"nbr\";s:2:\"21\";}i:87;a:2:{s:4:\"name\";s:13:\"DIA DEL PADRE\";s:3:\"nbr\";s:2:\"68\";}i:92;a:2:{s:4:\"name\";s:15:\"COLECCIÓN ané\";s:3:\"nbr\";s:1:\"5\";}i:93;a:2:{s:4:\"name\";s:15:\"JOYERÍA HOMBRE\";s:3:\"nbr\";s:2:\"20\";}i:94;a:2:{s:4:\"name\";s:9:\"TOBILLERA\";s:3:\"nbr\";s:1:\"4\";}i:95;a:2:{s:4:\"name\";s:16:\"TOBILLERA DE ORO\";s:3:\"nbr\";s:1:\"3\";}i:98;a:2:{s:4:\"name\";s:15:\"ALIANZAS DE ORO\";s:3:\"nbr\";s:1:\"1\";}i:102;a:2:{s:4:\"name\";s:10:\"CADENA ORO\";s:3:\"nbr\";s:1:\"4\";}i:104;a:2:{s:4:\"name\";s:20:\"sello hombre oro 18k\";s:3:\"nbr\";s:1:\"7\";}i:105;a:2:{s:4:\"name\";s:7:\"ALIANZA\";s:3:\"nbr\";s:2:\"15\";}i:106;a:2:{s:4:\"name\";s:18:\"COLGANTES DE ACERO\";s:3:\"nbr\";s:1:\"2\";}i:107;a:2:{s:4:\"name\";s:14:\"ALIANZAS ACERO\";s:3:\"nbr\";s:1:\"3\";}i:112;a:3:{s:4:\"name\";s:16:\"PENDIENTES PLATA\";s:3:\"nbr\";s:1:\"1\";s:7:\"checked\";b:1;}i:113;a:3:{s:4:\"name\";s:7:\"PENJOLL\";s:3:\"nbr\";s:1:\"1\";s:7:\"checked\";b:1;}i:115;a:3:{s:4:\"name\";s:5:\"LATON\";s:3:\"nbr\";s:1:\"3\";s:7:\"checked\";b:1;}i:116;a:2:{s:4:\"name\";s:18:\"LLAMADOR DE ÁNGEL\";s:3:\"nbr\";s:1:\"3\";}i:117;a:2:{s:4:\"name\";s:15:\"Sant Fèlix 325\";s:3:\"nbr\";s:1:\"9\";}i:118;a:2:{s:4:\"name\";s:9:\"TOBILLERA\";s:3:\"nbr\";s:1:\"5\";}i:119;a:2:{s:4:\"name\";s:7:\"GEMELOS\";s:3:\"nbr\";s:1:\"2\";}i:121;a:2:{s:4:\"name\";s:23:\"ANILLOS ORO & CIRCONITA\";s:3:\"nbr\";s:1:\"1\";}i:122;a:2:{s:4:\"name\";s:16:\"CLAUDIA CAMPILLO\";s:3:\"nbr\";s:1:\"1\";}i:123;a:2:{s:4:\"name\";s:24:\"DIAMANTES DE LABORATORIO\";s:3:\"nbr\";s:2:\"12\";}i:124;a:2:{s:4:\"name\";s:7:\"ORO 14K\";s:3:\"nbr\";s:2:\"28\";}i:125;a:2:{s:4:\"name\";s:15:\"PIERCING DE 14K\";s:3:\"nbr\";s:2:\"27\";}}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";s:1:\"0\";}}}")
 13.139 ms 1 /modules/ps_facetedsearch/src/Filters/Block.php:209
816 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4463) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
 13.116 ms 1 Yes /classes/Product.php:4513
382 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1014
AND image_shop.`cover` = 1 LIMIT 1
 12.965 ms 1 /classes/Product.php:3570
393 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1014
ORDER BY f.position ASC
 12.942 ms 1 Yes /classes/Product.php:6024
318 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 997
ORDER BY f.position ASC
 12.654 ms 1 Yes /classes/Product.php:6024
805 
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module` WHERE `name` = "iqitlinksmanager" LIMIT 1
 12.647 ms 1 /classes/module/Module.php:2664
142 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 970
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 12.460 ms 0 /classes/SpecificPrice.php:256
677 
SELECT SQL_NO_CACHE *
FROM `prstshp_product_attribute` a
LEFT JOIN `prstshp_product_attribute_shop` `c` ON a.`id_product_attribute` = c.`id_product_attribute` AND c.`id_shop` = 1
WHERE (a.`id_product_attribute` = 5219) LIMIT 1
 11.968 ms 1 /src/Adapter/EntityMapper.php:71
817 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4462) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
 11.850 ms 1 Yes /classes/Product.php:4513
13 
SELECT SQL_NO_CACHE h.`name` as hook, m.`id_module`, h.`id_hook`, m.`name` as module
FROM `prstshp_module` m
INNER JOIN prstshp_module_shop module_shop
ON (module_shop.id_module = m.id_module AND module_shop.id_shop = 1 AND module_shop.enable_device & 1)
INNER JOIN `prstshp_hook_module` `hm` ON hm.`id_module` = m.`id_module`
INNER JOIN `prstshp_hook` `h` ON hm.`id_hook` = h.`id_hook`
LEFT JOIN `prstshp_module_group` `mg` ON mg.`id_module` = m.`id_module`
WHERE (h.`name` != "paymentOptions") AND (hm.`id_shop` = 1) AND (mg.id_shop = 1 AND  mg.`id_group` IN (1))
GROUP BY hm.id_hook, hm.id_module
ORDER BY hm.`position`
 10.958 ms 114 Yes Yes /classes/Hook.php:1289
488 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 4435 LIMIT 1
 10.944 ms 1 /classes/SpecificPrice.php:435
9 
SELECT SQL_NO_CACHE id_shop
FROM `prstshp_lang_shop`
WHERE `id_lang` = 2
AND id_shop = 1 LIMIT 1
 10.857 ms 1 /classes/ObjectModel.php:1727
12 
SELECT SQL_NO_CACHE lower(name) as name
FROM `prstshp_hook` h
WHERE (h.active = 1)
 10.827 ms 1097 /classes/Hook.php:1388
14 
SELECT SQL_NO_CACHE `name`, `alias` FROM `prstshp_hook_alias`
 10.725 ms 88 /classes/Hook.php:290
2 
SELECT SQL_NO_CACHE c.`name`, cl.`id_lang`, IF(cl.`id_lang` IS NULL, c.`value`, cl.`value`) AS value, c.id_shop_group, c.id_shop
FROM `prstshp_configuration` c
LEFT JOIN `prstshp_configuration_lang` cl ON (c.`id_configuration` = cl.`id_configuration`)
 10.365 ms 1360 /classes/Configuration.php:180
3 
SELECT SQL_NO_CACHE *
FROM `prstshp_shop` a
WHERE (a.`id_shop` = 1) LIMIT 1
 10.351 ms 1 /src/Adapter/EntityMapper.php:71
542 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 4421) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 10.226 ms 1 /classes/stock/StockAvailable.php:453
783 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 4403
ORDER BY `position`
 10.167 ms 4 Yes /classes/Product.php:3539
11 
SELECT SQL_NO_CACHE COUNT(DISTINCT l.id_lang) FROM `prstshp_lang` l
JOIN prstshp_lang_shop lang_shop ON (lang_shop.id_lang = l.id_lang AND lang_shop.id_shop = 1)
WHERE l.`active` = 1 LIMIT 1
 10.167 ms 4 /classes/Language.php:1214
61 
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 124) AND (b.`id_shop` = 1) LIMIT 1
 9.710 ms 1 /src/Adapter/EntityMapper.php:71
865 
INSERT INTO `prstshp_guest` (`id_operating_system`, `id_web_browser`, `id_customer`, `javascript`, `screen_resolution_x`, `screen_resolution_y`, `screen_color`, `sun_java`, `adobe_flash`, `adobe_director`, `apple_quicktime`, `real_player`, `windows_media`, `accept_language`, `mobile_theme`) VALUES ('0', '0', '0', '0', '0', '0', '0', '0', '0', '0', '0', '0', '0', '', '0')
 9.577 ms 1 /classes/ObjectModel.php:622
22 
SELECT SQL_NO_CACHE `id_lang` FROM `prstshp_lang`
WHERE `locale` = 'es-es'
OR `language_code` = 'es-es' LIMIT 1
 9.188 ms 2 /classes/Language.php:880
183 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 975) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 8.648 ms 1 /classes/stock/StockAvailable.php:453
16 
SELECT SQL_NO_CACHE `id_hook`, `name` FROM `prstshp_hook`
 8.630 ms 1097 /classes/Hook.php:1348
311 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 997 AND id_shop=1 LIMIT 1
 7.947 ms 1 /classes/Product.php:6884
412 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4464
AND image_shop.`cover` = 1 LIMIT 1
 7.686 ms 1 /classes/Product.php:3570
798 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 4390
ORDER BY `position`
 7.661 ms 1 Yes /classes/Product.php:3539
479 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4452)
 7.573 ms 1 /classes/Product.php:3860
113 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 967) AND (b.`id_shop` = 1) LIMIT 1
 7.337 ms 1 /src/Adapter/EntityMapper.php:71
744 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 4452
ORDER BY `position`
 7.035 ms 1 Yes /classes/Product.php:3539
184 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 975 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 975 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 6.183 ms 0 /classes/Cart.php:1430
589 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 4417 AND `id_group` = 1 LIMIT 1
 5.641 ms 0 /classes/GroupReduction.php:153
792 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 4398
ORDER BY `position`
 5.597 ms 4 Yes /classes/Product.php:3539
364 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1012)
 5.335 ms 1 /classes/Product.php:3860
843 
SELECT SQL_NO_CACHE pa.*, product_attribute_shop.*
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 4399
GROUP BY pa.`id_product_attribute`
ORDER BY pa.`id_product_attribute`
 5.028 ms 2 Yes Yes /classes/Product.php:2731
808 
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module` WHERE `name` = "ps_languageselector" LIMIT 1
 4.760 ms 1 /classes/module/Module.php:2664
676 
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `prstshp_attribute` a
LEFT JOIN `prstshp_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 2)
LEFT JOIN `prstshp_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `prstshp_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 2)
LEFT JOIN `prstshp_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 2)
WHERE pa.`id_product` = 4399
AND pac.`id_product_attribute` = 5219
AND agl.`id_lang` = 2
 4.686 ms 2 /classes/Product.php:7528
497 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4430
AND image_shop.`cover` = 1 LIMIT 1
 4.402 ms 4 /classes/Product.php:3570
111 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `prstshp_category_lang` cl
WHERE `id_lang` = 2
AND cl.id_shop = 1 
AND cl.`id_category` = 18 LIMIT 1
 4.192 ms 1 /classes/Category.php:1373
851 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4397) LIMIT 1
 4.183 ms 1 /src/Adapter/EntityMapper.php:71
200 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 986) AND (b.`id_shop` = 1) LIMIT 1
 4.080 ms 1 /src/Adapter/EntityMapper.php:71
313 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 997) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 4.080 ms 1 /classes/stock/StockAvailable.php:453
813 
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module` WHERE `name` = "iqitmegamenu" LIMIT 1
 3.958 ms 1 /classes/module/Module.php:2664
104 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 959)
 3.781 ms 1 /classes/Product.php:3860
88 
SELECT SQL_NO_CACHE `id_hook`, `name`
FROM `prstshp_hook`
UNION
SELECT `id_hook`, ha.`alias` as name
FROM `prstshp_hook_alias` ha
INNER JOIN `prstshp_hook` h ON ha.name = h.name
 3.767 ms 0 /classes/Hook.php:1348
270 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 993
AND image_shop.`cover` = 1 LIMIT 1
 3.729 ms 1 /classes/Product.php:3570
89 
SELECT SQL_NO_CACHE h.id_hook, h.name as h_name, title, description, h.position, hm.position as hm_position, m.id_module, m.name, m.active
FROM `prstshp_hook_module` hm
STRAIGHT_JOIN `prstshp_hook` h ON (h.id_hook = hm.id_hook AND hm.id_shop = 1)
STRAIGHT_JOIN `prstshp_module` as m ON (m.id_module = hm.id_module)
ORDER BY hm.position
 3.704 ms 516 /classes/Hook.php:455
411 
SELECT SQL_NO_CACHE p.*,
ps.*,
pl.*,
sa.out_of_stock,
IFNULL(sa.quantity, 0) as quantity,
(DATEDIFF(
p.`date_add`,
DATE_SUB(
'2026-04-13 00:00:00',
INTERVAL 30 DAY
)
) > 0) as new
FROM prstshp_product p
LEFT JOIN prstshp_product_lang pl
ON pl.id_product = p.id_product
AND pl.id_shop = 1
AND pl.id_lang = 2
LEFT JOIN prstshp_stock_available sa   ON sa.id_product = p.id_product
AND sa.id_product_attribute = 0
AND sa.id_shop = 1 LEFT JOIN prstshp_product_shop ps
ON ps.id_product = p.id_product
AND ps.id_shop = 1
WHERE p.id_product IN (4464,4463,4462,4459,4457,4452,4435,4430,4423,4422,4421,4420,4419,4418,4417,4414,4406,4404,4403,4400,4399,4398,4397,4390)
 3.623 ms 24 /classes/ProductAssembler.php:95
19 
SELECT SQL_NO_CACHE name, alias FROM `prstshp_hook_alias`
 3.476 ms 88 /classes/Hook.php:342
634 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4404 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4404 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 3.312 ms 0 /classes/Cart.php:1430
60 
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 117) AND (b.`id_shop` = 1) LIMIT 1
 3.208 ms 1 /src/Adapter/EntityMapper.php:71
369 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1012
ORDER BY f.position ASC
 3.198 ms 1 Yes /classes/Product.php:6024
90 
SELECT SQL_NO_CACHE tr.*
FROM `prstshp_tax_rule` tr
JOIN `prstshp_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 6
AND tr.`id_tax_rules_group` = 53
AND tr.`id_state` IN (0, 362)
AND ('08720' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '08720')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
 3.112 ms 2 /classes/tax/TaxRulesTaxManager.php:100
869 
INSERT INTO `prstshp_connections` (`id_guest`, `id_page`, `ip_address`, `http_referer`, `id_shop`, `id_shop_group`, `date_add`) VALUES ('1363', '118', '3628718218', '', '1', '1', '2026-04-13 13:03:00')
 3.057 ms 1 /classes/ObjectModel.php:622
376 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1013)
 3.037 ms 1 /classes/Product.php:3860
18 
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `prstshp_module` m
LEFT JOIN `prstshp_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
 2.911 ms 102 /classes/module/Module.php:341
25 
SELECT SQL_NO_CACHE *
FROM `prstshp_currency` a
LEFT JOIN `prstshp_currency_lang` `b` ON a.`id_currency` = b.`id_currency` AND b.`id_lang` = 2
LEFT JOIN `prstshp_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 2) LIMIT 1
 2.905 ms 1 /src/Adapter/EntityMapper.php:71
57 
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 122) AND (b.`id_shop` = 1) LIMIT 1
 2.896 ms 1 /src/Adapter/EntityMapper.php:71
6 
SELECT SQL_NO_CACHE *
FROM `prstshp_country` a
LEFT JOIN `prstshp_country_lang` `b` ON a.`id_country` = b.`id_country` AND b.`id_lang` = 2
LEFT JOIN `prstshp_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 6) LIMIT 1
 2.891 ms 1 /src/Adapter/EntityMapper.php:71
349 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1009 LIMIT 1
 2.884 ms 1 /classes/SpecificPrice.php:435
753 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 4423
ORDER BY `position`
 2.833 ms 1 Yes /classes/Product.php:3539
621 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 4406) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 2.759 ms 1 /classes/stock/StockAvailable.php:453
135 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 969) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 2.753 ms 1 /classes/stock/StockAvailable.php:453
143 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 970 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 2.694 ms 1 Yes /classes/SpecificPrice.php:576
733 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 4463
 2.685 ms 1 /classes/Product.php:2899
276 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 993)
 2.608 ms 1 /classes/Product.php:3860
358 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1012
AND image_shop.`cover` = 1 LIMIT 1
 2.391 ms 1 /classes/Product.php:3570
754 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 4423
 2.318 ms 1 /classes/Product.php:2899
381 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1013
ORDER BY f.position ASC
 2.250 ms 1 Yes /classes/Product.php:6024
636 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4403
AND image_shop.`cover` = 1 LIMIT 1
 2.167 ms 4 /classes/Product.php:3570
501 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 4430
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 2.160 ms 0 /classes/SpecificPrice.php:256
64 
SELECT SQL_NO_CACHE * FROM `prstshp_image_type` WHERE 1 AND `products` = 1  ORDER BY `width` DESC, `height` DESC, `name`ASC
 2.137 ms 8 Yes /classes/ImageType.php:109
373 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1013 LIMIT 1
 2.124 ms 1 /classes/SpecificPrice.php:435
357 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1009
ORDER BY f.position ASC
 2.123 ms 1 Yes /classes/Product.php:6024
389 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1014 AND id_shop=1 LIMIT 1
 2.098 ms 1 /classes/Product.php:6884
144 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 970)
 2.096 ms 1 /classes/Product.php:3860
388 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1014)
 2.070 ms 1 /classes/Product.php:3860
126 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 969
AND image_shop.`cover` = 1 LIMIT 1
 2.057 ms 3 /classes/Product.php:3570
361 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1012 LIMIT 1
 2.055 ms 1 /classes/SpecificPrice.php:435
42 
SELECT SQL_NO_CACHE state FROM prstshp_feature_flag WHERE name = 'multiple_image_format' LIMIT 1
 2.039 ms 1 /classes/FeatureFlag.php:105
85 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 948 LIMIT 1
 2.039 ms 1 /classes/SpecificPrice.php:435
47 
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 17) AND (b.`id_shop` = 1) LIMIT 1
 1.945 ms 1 /src/Adapter/EntityMapper.php:71
512 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 4423 LIMIT 1
 1.933 ms 1 /classes/SpecificPrice.php:435
293 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 996 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 1.911 ms 1 Yes /classes/SpecificPrice.php:576
837 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4406) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
 1.902 ms 1 Yes /classes/Product.php:4513
140 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 970) AND (b.`id_shop` = 1) LIMIT 1
 1.894 ms 1 /src/Adapter/EntityMapper.php:71
152 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 971) AND (b.`id_shop` = 1) LIMIT 1
 1.861 ms 1 /src/Adapter/EntityMapper.php:71
279 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 993) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 1.857 ms 1 /classes/stock/StockAvailable.php:453
371 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 1.846 ms 1 /classes/Product.php:5670
132 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 969)
 1.841 ms 1 /classes/Product.php:3860
635 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4404
ORDER BY f.position ASC
 1.839 ms 1 Yes /classes/Product.php:6024
345 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 999
ORDER BY f.position ASC
 1.813 ms 1 Yes /classes/Product.php:6024
340 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 999)
 1.808 ms 1 /classes/Product.php:3860
818 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4459) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
 1.797 ms 1 Yes /classes/Product.php:4513
819 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4457) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
 1.797 ms 1 Yes /classes/Product.php:4513
823 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4423) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
 1.790 ms 1 Yes /classes/Product.php:4513
294 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 996) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 1.785 ms 1 /classes/stock/StockAvailable.php:453
346 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1009
AND image_shop.`cover` = 1 LIMIT 1
 1.772 ms 1 /classes/Product.php:3570
20 
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 2) AND (b.`id_shop` = 1) LIMIT 1
 1.743 ms 1 /src/Adapter/EntityMapper.php:71
258 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 992
AND image_shop.`cover` = 1 LIMIT 1
 1.743 ms 1 /classes/Product.php:3570
491 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4435)
 1.723 ms 1 /classes/Product.php:3860
319 
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `prstshp_attribute` a
LEFT JOIN `prstshp_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 2)
LEFT JOIN `prstshp_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `prstshp_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 2)
LEFT JOIN `prstshp_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 2)
WHERE pa.`id_product` = 997
AND pac.`id_product_attribute` = 1793
AND agl.`id_lang` = 2
 1.709 ms 2 /classes/Product.php:7528
675 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4399
ORDER BY f.position ASC
 1.709 ms 1 Yes /classes/Product.php:6024
175 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 1.687 ms 1 /classes/Product.php:5670
23 
SELECT SQL_NO_CACHE value FROM `prstshp_configuration` WHERE `name` = "PS_MULTISHOP_FEATURE_ACTIVE" LIMIT 1
 1.683 ms 1 /classes/shop/Shop.php:1183
131 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 969 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 1.676 ms 1 Yes /classes/SpecificPrice.php:576
333 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 998
ORDER BY f.position ASC
 1.650 ms 1 Yes /classes/Product.php:6024
674 
SELECT SQL_NO_CACHE pa.`available_date` FROM `prstshp_product` p LEFT JOIN `prstshp_product_attribute` pa ON (pa.`id_product` = p.`id_product`) INNER JOIN prstshp_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1) INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) WHERE p.`id_product` = 4399 AND pa.`id_product` = 4399 AND pa.`id_product_attribute` = 5219 LIMIT 1
 1.636 ms 1 /classes/Product.php:1209
267 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 992) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 1.627 ms 1 /classes/stock/StockAvailable.php:453
821 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4435) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
 1.625 ms 1 Yes /classes/Product.php:4513
820 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4452) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
 1.619 ms 1 Yes /classes/Product.php:4513
303 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 997
AND image_shop.`cover` = 1 LIMIT 1
 1.597 ms 2 /classes/Product.php:3570
320 
SELECT SQL_NO_CACHE *
FROM `prstshp_product_attribute` a
LEFT JOIN `prstshp_product_attribute_shop` `c` ON a.`id_product_attribute` = c.`id_product_attribute` AND c.`id_shop` = 1
WHERE (a.`id_product_attribute` = 1793) LIMIT 1
 1.579 ms 1 /src/Adapter/EntityMapper.php:71
826 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4420) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
 1.573 ms 1 Yes /classes/Product.php:4513
301 
SELECT SQL_NO_CACHE *
FROM `prstshp_product_attribute` a
LEFT JOIN `prstshp_product_attribute_shop` `c` ON a.`id_product_attribute` = c.`id_product_attribute` AND c.`id_shop` = 1
WHERE (a.`id_product_attribute` = 1791) LIMIT 1
 1.570 ms 1 /src/Adapter/EntityMapper.php:71
252 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 991)
 1.563 ms 1 /classes/Product.php:3860
273 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 993 LIMIT 1
 1.560 ms 1 /classes/SpecificPrice.php:435
825 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4421) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
 1.541 ms 1 Yes /classes/Product.php:4513
281 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 993
ORDER BY f.position ASC
 1.537 ms 1 Yes /classes/Product.php:6024
824 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4422) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
 1.536 ms 1 Yes /classes/Product.php:4513
822 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4430) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
 1.529 ms 1 Yes /classes/Product.php:4513
839 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4403) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
 1.529 ms 1 Yes /classes/Product.php:4513
828 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4418) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
 1.525 ms 1 Yes /classes/Product.php:4513
122 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 967 AND `id_group` = 1 LIMIT 1
 1.512 ms 0 /classes/GroupReduction.php:153
829 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4417) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
 1.511 ms 1 Yes /classes/Product.php:4513
827 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4419) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
 1.506 ms 1 Yes /classes/Product.php:4513
838 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4404) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
 1.491 ms 1 Yes /classes/Product.php:4513
840 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4400) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
 1.478 ms 1 Yes /classes/Product.php:4513
247 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 1.477 ms 1 /classes/Product.php:5670
584 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 4417 LIMIT 1
 1.474 ms 1 /classes/SpecificPrice.php:435
100 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 959
AND image_shop.`cover` = 1 LIMIT 1
 1.466 ms 2 /classes/Product.php:3570
755 
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (5246) AND il.`id_lang` = 2 ORDER by i.`position`
 1.448 ms 1 Yes /classes/Product.php:2915
264 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 992)
 1.440 ms 1 /classes/Product.php:3860
108 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 959 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 959 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 1.438 ms 0 /classes/Cart.php:1430
377 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1013 AND id_shop=1 LIMIT 1
 1.433 ms 1 /classes/Product.php:6884
98 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 948
ORDER BY f.position ASC
 1.383 ms 1 Yes /classes/Product.php:6024
500 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 4430 LIMIT 1
 1.377 ms 1 /classes/SpecificPrice.php:435
356 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1009 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1009 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 1.353 ms 0 /classes/Cart.php:1430
106 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 959 AND `id_group` = 1 LIMIT 1
 1.350 ms 0 /classes/GroupReduction.php:153
325 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 998 LIMIT 1
 1.350 ms 1 /classes/SpecificPrice.php:435
260 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 992) AND (b.`id_shop` = 1) LIMIT 1
 1.336 ms 1 /src/Adapter/EntityMapper.php:71
261 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 992 LIMIT 1
 1.332 ms 1 /classes/SpecificPrice.php:435
298 
SELECT SQL_NO_CACHE pa.`available_date` FROM `prstshp_product` p LEFT JOIN `prstshp_product_attribute` pa ON (pa.`id_product` = p.`id_product`) INNER JOIN prstshp_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1) INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) WHERE p.`id_product` = 996 AND pa.`id_product` = 996 AND pa.`id_product_attribute` = 1791 LIMIT 1
 1.330 ms 1 /classes/Product.php:1209
306 
SELECT SQL_NO_CACHE product_attribute_shop.`price`
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.`id_product_attribute` = 1793 LIMIT 1
 1.327 ms 1 /classes/Combination.php:560
659 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4400
ORDER BY f.position ASC
 1.310 ms 1 Yes /classes/Product.php:6024
240 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 990)
 1.308 ms 1 /classes/Product.php:3860
394 
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a0
LEFT JOIN `prstshp_category_lang` `a1` ON (a0.`id_category` = a1.`id_category`)
WHERE (a0.`nleft` < 2) AND (a0.`nright` > 197) AND (a1.`id_lang` = 2) AND (a1.`id_shop` = 1)
ORDER BY a0.`nleft` asc
 1.305 ms 1 /classes/PrestaShopCollection.php:383
266 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 992 AND `id_group` = 1 LIMIT 1
 1.305 ms 0 /classes/GroupReduction.php:153
337 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 999 LIMIT 1
 1.302 ms 1 /classes/SpecificPrice.php:435
327 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 998 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 1.300 ms 1 Yes /classes/SpecificPrice.php:576
245 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 990
ORDER BY f.position ASC
 1.299 ms 1 Yes /classes/Product.php:6024
370 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1013
AND image_shop.`cover` = 1 LIMIT 1
 1.296 ms 1 /classes/Product.php:3570
134 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 969 AND `id_group` = 1 LIMIT 1
 1.281 ms 0 /classes/GroupReduction.php:153
639 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 4403 LIMIT 1
 1.277 ms 1 /classes/SpecificPrice.php:435
45 
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 15) AND (b.`id_shop` = 1) LIMIT 1
 1.265 ms 1 /src/Adapter/EntityMapper.php:71
846 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4398) LIMIT 1
 1.259 ms 1 /src/Adapter/EntityMapper.php:71
496 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4435
ORDER BY f.position ASC
 1.254 ms 1 Yes /classes/Product.php:6024
110 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 967
AND image_shop.`cover` = 1 LIMIT 1
 1.251 ms 2 /classes/Product.php:3570
705 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4397)
 1.247 ms 1 /classes/Product.php:3860
841 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4399) LIMIT 1
 1.245 ms 1 /src/Adapter/EntityMapper.php:71
138 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 970
AND image_shop.`cover` = 1 LIMIT 1
 1.243 ms 3 /classes/Product.php:3570
95 
SELECT SQL_NO_CACHE tr.*
FROM `prstshp_tax_rule` tr
JOIN `prstshp_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 6
AND tr.`id_tax_rules_group` = 0
AND tr.`id_state` IN (0, 362)
AND ('08720' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '08720')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
 1.225 ms 0 /classes/tax/TaxRulesTaxManager.php:100
368 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1012 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1012 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 1.214 ms 0 /classes/Cart.php:1430
672 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 4399) AND (id_product_attribute = 5219) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 1.207 ms 1 /classes/stock/StockAvailable.php:453
246 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 991
AND image_shop.`cover` = 1 LIMIT 1
 1.207 ms 1 /classes/Product.php:3570
730 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 4464
 1.205 ms 1 /classes/Product.php:2899
317 
SELECT SQL_NO_CACHE pa.`available_date` FROM `prstshp_product` p LEFT JOIN `prstshp_product_attribute` pa ON (pa.`id_product` = p.`id_product`) INNER JOIN prstshp_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1) INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) WHERE p.`id_product` = 997 AND pa.`id_product` = 997 AND pa.`id_product_attribute` = 1793 LIMIT 1
 1.203 ms 1 /classes/Product.php:1209
831 
SELECT SQL_NO_CACHE *
FROM `prstshp_product_lang`
WHERE `id_product` = 4414 AND `id_shop` = 1
 1.200 ms 2 /src/Adapter/EntityMapper.php:79
128 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 969) AND (b.`id_shop` = 1) LIMIT 1
 1.199 ms 1 /src/Adapter/EntityMapper.php:71
321 
SELECT SQL_NO_CACHE *
FROM `prstshp_product_attribute_lang`
WHERE `id_product_attribute` = 1793
 1.197 ms 2 /src/Adapter/EntityMapper.php:79
835 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 4414) AND (id_product_attribute = 5237) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 1.189 ms 1 /classes/stock/StockAvailable.php:453
145 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 970 AND id_shop=1 LIMIT 1
 1.178 ms 1 /classes/Product.php:6884
503 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4430)
 1.176 ms 1 /classes/Product.php:3860
352 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1009)
 1.175 ms 1 /classes/Product.php:3860
638 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4403) AND (b.`id_shop` = 1) LIMIT 1
 1.172 ms 1 /src/Adapter/EntityMapper.php:71
504 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 4430 AND id_shop=1 LIMIT 1
 1.171 ms 1 /classes/Product.php:6884
102 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 959) AND (b.`id_shop` = 1) LIMIT 1
 1.161 ms 1 /src/Adapter/EntityMapper.php:71
315 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 997) AND (id_product_attribute = 1793) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 1.160 ms 1 /classes/stock/StockAvailable.php:453
353 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1009 AND id_shop=1 LIMIT 1
 1.150 ms 1 /classes/Product.php:6884
271 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 1.132 ms 1 /classes/Product.php:5670
46 
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 16) AND (b.`id_shop` = 1) LIMIT 1
 1.131 ms 1 /src/Adapter/EntityMapper.php:71
666 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 4399 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 1.124 ms 1 Yes /classes/SpecificPrice.php:576
323 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 1.122 ms 1 /classes/Product.php:5670
17 
SELECT SQL_NO_CACHE * FROM `prstshp_hook_module_exceptions`
WHERE `id_shop` IN (1)
 1.121 ms 1 /classes/module/Module.php:2046
344 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 999 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 999 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 1.117 ms 0 /classes/Cart.php:1430
810 
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module` WHERE `name` = "ps_currencyselector" LIMIT 1
 1.115 ms 1 /classes/module/Module.php:2664
536 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 4421 LIMIT 1
 1.114 ms 1 /classes/SpecificPrice.php:435
360 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1012) AND (b.`id_shop` = 1) LIMIT 1
 1.090 ms 1 /src/Adapter/EntityMapper.php:71
363 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1012 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 1.083 ms 1 Yes /classes/SpecificPrice.php:576
316 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 1793
AND cp.`id_cart` = 0 AND cp.`id_product` = 997 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 1793
AND cp.`id_cart` = 0 AND p.`id_product_item` = 997 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 1.081 ms 0 /classes/Cart.php:1430
339 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 999 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 1.077 ms 1 Yes /classes/SpecificPrice.php:576
365 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1012 AND id_shop=1 LIMIT 1
 1.076 ms 1 /classes/Product.php:6884
120 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 967)
 1.069 ms 1 /classes/Product.php:3860
43 
SELECT SQL_NO_CACHE * FROM `prstshp_image_type` WHERE 1 AND `categories` = 1  ORDER BY `width` DESC, `height` DESC, `name`ASC
 1.068 ms 8 Yes /classes/ImageType.php:109
308 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 997
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 1.059 ms 0 /classes/SpecificPrice.php:256
406 
SELECT SQL_NO_CACHE data FROM prstshp_layered_filter_block WHERE hash="9ddd1ed134d72631863f43468c8e4bce" LIMIT 1
 1.057 ms 1 /modules/ps_facetedsearch/src/Filters/Block.php:185
520 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4423
ORDER BY f.position ASC
 1.056 ms 1 Yes /classes/Product.php:6024
380 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1013 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1013 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 1.055 ms 0 /classes/Cart.php:1430
278 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 993 AND `id_group` = 1 LIMIT 1
 1.051 ms 0 /classes/GroupReduction.php:153
390 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1014 AND `id_group` = 1 LIMIT 1
 1.050 ms 0 /classes/GroupReduction.php:153
328 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 998)
 1.042 ms 1 /classes/Product.php:3860
728 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4390
ORDER BY f.position ASC
 1.042 ms 1 Yes /classes/Product.php:6024
141 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 970 LIMIT 1
 1.040 ms 1 /classes/SpecificPrice.php:435
285 
SELECT SQL_NO_CACHE product_attribute_shop.`price`
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.`id_product_attribute` = 1791 LIMIT 1
 1.038 ms 1 /classes/Combination.php:560
297 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 1791
AND cp.`id_cart` = 0 AND cp.`id_product` = 996 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 1791
AND cp.`id_cart` = 0 AND p.`id_product_item` = 996 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 1.026 ms 0 /classes/Cart.php:1430
499 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4430) AND (b.`id_shop` = 1) LIMIT 1
 1.019 ms 1 /src/Adapter/EntityMapper.php:71
336 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 999) AND (b.`id_shop` = 1) LIMIT 1
 1.017 ms 1 /src/Adapter/EntityMapper.php:71
149 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 970
ORDER BY f.position ASC
 1.016 ms 1 Yes /classes/Product.php:6024
782 
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (5224) AND il.`id_lang` = 2 ORDER by i.`position`
 1.009 ms 1 Yes /classes/Product.php:2915
288 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 996
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 1.007 ms 0 /classes/SpecificPrice.php:256
348 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1009) AND (b.`id_shop` = 1) LIMIT 1
 1.007 ms 1 /src/Adapter/EntityMapper.php:71
395 
SELECT SQL_NO_CACHE `name`
FROM `prstshp_hook`
WHERE `id_hook` = 746 LIMIT 1
 0.999 ms 1 /classes/Hook.php:244
125 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 967
ORDER BY f.position ASC
 0.994 ms 1 Yes /classes/Product.php:6024
667 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4399)
 0.994 ms 1 /classes/Product.php:3860
255 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 991) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.988 ms 1 /classes/stock/StockAvailable.php:453
633 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 4404) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.983 ms 1 /classes/stock/StockAvailable.php:453
637 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.981 ms 1 /classes/Product.php:5670
686 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4398)
 0.980 ms 1 /classes/Product.php:3860
695 
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `prstshp_attribute` a
LEFT JOIN `prstshp_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 2)
LEFT JOIN `prstshp_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `prstshp_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 2)
LEFT JOIN `prstshp_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 2)
WHERE pa.`id_product` = 4398
AND pac.`id_product_attribute` = 6947
AND agl.`id_lang` = 2
 0.978 ms 2 /classes/Product.php:7528
40 
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 96) AND (b.`id_shop` = 1) LIMIT 1
 0.976 ms 1 /src/Adapter/EntityMapper.php:71
53 
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 86) AND (b.`id_shop` = 1) LIMIT 1
 0.971 ms 1 /src/Adapter/EntityMapper.php:71
747 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 4435
ORDER BY `position`
 0.961 ms 2 Yes /classes/Product.php:3539
714 
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `prstshp_attribute` a
LEFT JOIN `prstshp_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 2)
LEFT JOIN `prstshp_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `prstshp_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 2)
LEFT JOIN `prstshp_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 2)
WHERE pa.`id_product` = 4397
AND pac.`id_product_attribute` = 5215
AND agl.`id_lang` = 2
 0.961 ms 2 /classes/Product.php:7528
97 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 948 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 948 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.959 ms 0 /classes/Cart.php:1430
506 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 4430) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.947 ms 1 /classes/stock/StockAvailable.php:453
310 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 997)
 0.945 ms 1 /classes/Product.php:3860
385 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1014 LIMIT 1
 0.938 ms 1 /classes/SpecificPrice.php:435
375 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1013 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.930 ms 1 Yes /classes/SpecificPrice.php:576
351 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1009 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.921 ms 1 Yes /classes/SpecificPrice.php:576
119 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 967 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.920 ms 1 Yes /classes/SpecificPrice.php:576
681 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4398) AND (b.`id_shop` = 1) LIMIT 1
 0.920 ms 1 /src/Adapter/EntityMapper.php:71
341 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 999 AND id_shop=1 LIMIT 1
 0.911 ms 1 /classes/Product.php:6884
400 
SELECT SQL_NO_CACHE c.*, cl.*
FROM `prstshp_category` c
LEFT JOIN `prstshp_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 2 AND cl.id_shop = 1 )
WHERE `name` = 'JOYAS PERSONALIZADAS ORO'
AND c.`id_category` != 2
AND c.`id_parent` = 2 LIMIT 1
 0.911 ms 3 /classes/Category.php:1492
49 
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 70) AND (b.`id_shop` = 1) LIMIT 1
 0.908 ms 1 /src/Adapter/EntityMapper.php:71
83 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 948) AND (b.`id_shop` = 1) LIMIT 1
 0.903 ms 1 /src/Adapter/EntityMapper.php:71
118 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 967
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.902 ms 0 /classes/SpecificPrice.php:256
15 
SELECT SQL_NO_CACHE m.page, ml.url_rewrite, ml.id_lang
FROM `prstshp_meta` m
LEFT JOIN `prstshp_meta_lang` ml ON (m.id_meta = ml.id_meta AND ml.id_shop = 1 )
ORDER BY LENGTH(ml.url_rewrite) DESC
 0.895 ms 56 Yes /classes/Dispatcher.php:654
359 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.890 ms 1 /classes/Product.php:5670
795 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 4397
ORDER BY `position`
 0.889 ms 5 Yes /classes/Product.php:3539
579 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4418 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4418 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.887 ms 0 /classes/Cart.php:1430
524 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 4422 LIMIT 1
 0.884 ms 1 /classes/SpecificPrice.php:435
647 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4403
ORDER BY f.position ASC
 0.882 ms 1 Yes /classes/Product.php:6024
249 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 991 LIMIT 1
 0.874 ms 1 /classes/SpecificPrice.php:435
52 
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 79) AND (b.`id_shop` = 1) LIMIT 1
 0.873 ms 1 /src/Adapter/EntityMapper.php:71
347 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.872 ms 1 /classes/Product.php:5670
392 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1014 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1014 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.871 ms 0 /classes/Cart.php:1430
397 
SELECT SQL_NO_CACHE type, id_value, filter_show_limit, filter_type FROM prstshp_layered_category
WHERE controller = 'category'
AND id_category = 2
AND id_shop = 1
GROUP BY `type`, id_value ORDER BY position ASC
 0.864 ms 2 Yes Yes /modules/ps_facetedsearch/src/Filters/Provider.php:57
263 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 992 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.863 ms 1 Yes /classes/SpecificPrice.php:576
762 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 4420
ORDER BY `position`
 0.862 ms 1 Yes /classes/Product.php:3539
691 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 4398) AND (id_product_attribute = 6947) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.859 ms 1 /classes/stock/StockAvailable.php:453
1 
SELECT SQL_NO_CACHE gs.*, s.*, gs.name AS group_name, s.name AS shop_name, s.active, su.domain, su.domain_ssl, su.physical_uri, su.virtual_uri
FROM prstshp_shop_group gs
LEFT JOIN prstshp_shop s
ON s.id_shop_group = gs.id_shop_group
LEFT JOIN prstshp_shop_url su
ON s.id_shop = su.id_shop AND su.main = 1
WHERE s.deleted = 0
AND gs.deleted = 0
ORDER BY gs.name, s.name
 0.856 ms 1 Yes /classes/shop/Shop.php:715
54 
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 87) AND (b.`id_shop` = 1) LIMIT 1
 0.854 ms 1 /src/Adapter/EntityMapper.php:71
251 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 991 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.851 ms 1 Yes /classes/SpecificPrice.php:576
502 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 4430 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.850 ms 1 Yes /classes/SpecificPrice.php:576
127 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.841 ms 1 /classes/Product.php:5670
109 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 959
ORDER BY f.position ASC
 0.837 ms 1 Yes /classes/Product.php:6024
780 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 4404
ORDER BY `position`
 0.837 ms 5 Yes /classes/Product.php:3539
172 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 972 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 972 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.832 ms 0 /classes/Cart.php:1430
39 
SELECT SQL_NO_CACHE c.*, cl.`id_lang`, cl.`name`, cl.`description`, cl.`additional_description`, cl.`link_rewrite`, cl.`meta_title`, cl.`meta_keywords`, cl.`meta_description`
FROM `prstshp_category` c
INNER JOIN prstshp_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `prstshp_category_lang` cl ON (c.`id_category` = cl.`id_category` AND `id_lang` = 2  AND cl.id_shop = 1 )
LEFT JOIN `prstshp_category_group` cg ON (cg.`id_category` = c.`id_category`)
WHERE `id_parent` = 2
AND `active` = 1
AND cg.`id_group` =1
GROUP BY c.`id_category`
ORDER BY `level_depth` ASC, category_shop.`position` ASC
 0.831 ms 25 Yes Yes /classes/Category.php:916
331 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 998) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.825 ms 1 /classes/stock/StockAvailable.php:453
93 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 948 AND `id_group` = 1 LIMIT 1
 0.824 ms 0 /classes/GroupReduction.php:153
654 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4400)
 0.823 ms 1 /classes/Product.php:3860
515 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4423)
 0.822 ms 1 /classes/Product.php:3860
715 
SELECT SQL_NO_CACHE *
FROM `prstshp_product_attribute` a
LEFT JOIN `prstshp_product_attribute_shop` `c` ON a.`id_product_attribute` = c.`id_product_attribute` AND c.`id_shop` = 1
WHERE (a.`id_product_attribute` = 5215) LIMIT 1
 0.822 ms 1 /src/Adapter/EntityMapper.php:71
196 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 985 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 985 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.820 ms 0 /classes/Cart.php:1430
329 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 998 AND id_shop=1 LIMIT 1
 0.814 ms 1 /classes/Product.php:6884
153 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 971 LIMIT 1
 0.809 ms 1 /classes/SpecificPrice.php:435
750 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 4430
ORDER BY `position`
 0.807 ms 4 Yes /classes/Product.php:3539
48 
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 18) AND (b.`id_shop` = 1) LIMIT 1
 0.803 ms 1 /src/Adapter/EntityMapper.php:71
693 
SELECT SQL_NO_CACHE pa.`available_date` FROM `prstshp_product` p LEFT JOIN `prstshp_product_attribute` pa ON (pa.`id_product` = p.`id_product`) INNER JOIN prstshp_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1) INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) WHERE p.`id_product` = 4398 AND pa.`id_product` = 4398 AND pa.`id_product_attribute` = 6947 LIMIT 1
 0.794 ms 1 /classes/Product.php:1209
490 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 4435 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.790 ms 1 Yes /classes/SpecificPrice.php:576
562 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 4419 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.787 ms 1 Yes /classes/SpecificPrice.php:576
642 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4403)
 0.785 ms 1 /classes/Product.php:3860
92 
SELECT SQL_NO_CACHE *
FROM `prstshp_tax_lang`
WHERE `id_tax` = 53
 0.784 ms 2 /src/Adapter/EntityMapper.php:79
486 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.784 ms 1 /classes/Product.php:5670
723 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4390)
 0.784 ms 1 /classes/Product.php:3860
803 
SELECT SQL_NO_CACHE 1 FROM `prstshp_cart_rule` WHERE ((date_to >= "2026-04-13 00:00:00" AND date_to <= "2026-04-13 23:59:59") OR (date_from >= "2026-04-13 00:00:00" AND date_from <= "2026-04-13 23:59:59") OR (date_from < "2026-04-13 00:00:00" AND date_to > "2026-04-13 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
 0.777 ms 7 /classes/CartRule.php:357
124 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 967 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 967 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.776 ms 0 /classes/Cart.php:1430
696 
SELECT SQL_NO_CACHE *
FROM `prstshp_product_attribute` a
LEFT JOIN `prstshp_product_attribute_shop` `c` ON a.`id_product_attribute` = c.`id_product_attribute` AND c.`id_shop` = 1
WHERE (a.`id_product_attribute` = 6947) LIMIT 1
 0.767 ms 1 /src/Adapter/EntityMapper.php:71
727 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4390 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4390 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.767 ms 0 /classes/Cart.php:1430
176 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 975) AND (b.`id_shop` = 1) LIMIT 1
 0.765 ms 1 /src/Adapter/EntityMapper.php:71
713 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4397
ORDER BY f.position ASC
 0.759 ms 1 Yes /classes/Product.php:6024
284 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 996) AND (b.`id_shop` = 1) LIMIT 1
 0.758 ms 1 /src/Adapter/EntityMapper.php:71
489 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 4435
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.758 ms 0 /classes/SpecificPrice.php:256
302 
SELECT SQL_NO_CACHE *
FROM `prstshp_product_attribute_lang`
WHERE `id_product_attribute` = 1791
 0.755 ms 2 /src/Adapter/EntityMapper.php:79
116 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE `from` BETWEEN '2026-04-13 00:00:00' AND '2026-04-13 23:59:59' LIMIT 1
 0.754 ms 1 /classes/SpecificPrice.php:377
523 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4422) AND (b.`id_shop` = 1) LIMIT 1
 0.753 ms 1 /src/Adapter/EntityMapper.php:71
374 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1013
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.752 ms 0 /classes/SpecificPrice.php:256
531 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4422 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4422 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.752 ms 0 /classes/Cart.php:1430
362 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1012
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.751 ms 0 /classes/SpecificPrice.php:256
692 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 6947
AND cp.`id_cart` = 0 AND cp.`id_product` = 4398 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 6947
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4398 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.747 ms 0 /classes/Cart.php:1430
483 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4452 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4452 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.745 ms 0 /classes/Cart.php:1430
50 
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 59) AND (b.`id_shop` = 1) LIMIT 1
 0.742 ms 1 /src/Adapter/EntityMapper.php:71
107 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 959) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.740 ms 1 /classes/stock/StockAvailable.php:453
179 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 975 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.738 ms 1 Yes /classes/SpecificPrice.php:576
673 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 5219
AND cp.`id_cart` = 0 AND cp.`id_product` = 4399 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 5219
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4399 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.738 ms 0 /classes/Cart.php:1430
151 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.735 ms 1 /classes/Product.php:5670
309 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 997 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.732 ms 1 Yes /classes/SpecificPrice.php:576
332 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 998 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 998 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.732 ms 0 /classes/Cart.php:1430
86 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 948)
 0.728 ms 1 /classes/Product.php:3860
99 
SELECT SQL_NO_CACHE tr.*
FROM `prstshp_tax_rule` tr
JOIN `prstshp_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 6
AND tr.`id_tax_rules_group` = 53
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
 0.728 ms 1 /classes/tax/TaxRulesTaxManager.php:100
774 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 4414
ORDER BY `position`
 0.713 ms 1 Yes /classes/Product.php:3539
312 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 997 AND `id_group` = 1 LIMIT 1
 0.710 ms 0 /classes/GroupReduction.php:153
386 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1014
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.707 ms 0 /classes/SpecificPrice.php:256
314 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 997 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 997 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.706 ms 0 /classes/Cart.php:1430
155 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 971 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.706 ms 1 Yes /classes/SpecificPrice.php:576
185 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 975
ORDER BY f.position ASC
 0.705 ms 1 Yes /classes/Product.php:6024
690 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4398 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4398 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.699 ms 0 /classes/Cart.php:1430
150 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 971
AND image_shop.`cover` = 1 LIMIT 1
 0.697 ms 3 /classes/Product.php:3570
91 
SELECT SQL_NO_CACHE *
FROM `prstshp_tax` a
WHERE (a.`id_tax` = 53) LIMIT 1
 0.696 ms 1 /src/Adapter/EntityMapper.php:71
712 
SELECT SQL_NO_CACHE pa.`available_date` FROM `prstshp_product` p LEFT JOIN `prstshp_product_attribute` pa ON (pa.`id_product` = p.`id_product`) INNER JOIN prstshp_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1) INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) WHERE p.`id_product` = 4397 AND pa.`id_product` = 4397 AND pa.`id_product_attribute` = 5215 LIMIT 1
 0.691 ms 1 /classes/Product.php:1209
513 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 4423
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.685 ms 0 /classes/SpecificPrice.php:256
280 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 993 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 993 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.684 ms 0 /classes/Cart.php:1430
326 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 998
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.681 ms 0 /classes/SpecificPrice.php:256
801 
SELECT SQL_NO_CACHE c.id_elementor FROM prstshp_iqit_elementor_category c WHERE c.id_category = 2 LIMIT 1
 0.680 ms 1 /modules/iqitelementor/src/IqitElementorCategory.php:87
732 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 4463
ORDER BY `position`
 0.679 ms 1 Yes /classes/Product.php:3539
171 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 972) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.675 ms 1 /classes/stock/StockAvailable.php:453
687 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 4398 AND id_shop=1 LIMIT 1
 0.675 ms 1 /classes/Product.php:6884
268 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 992 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 992 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.670 ms 0 /classes/Cart.php:1430
670 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 4399) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.670 ms 1 /classes/stock/StockAvailable.php:453
646 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4403 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4403 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.669 ms 0 /classes/Cart.php:1430
396 
SELECT SQL_NO_CACHE `id_category`
FROM `prstshp_category_shop`
WHERE `id_category` = 2
AND `id_shop` = 1 LIMIT 1
 0.666 ms 1 /classes/Category.php:2446
168 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 972)
 0.663 ms 1 /classes/Product.php:3860
167 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 972 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.661 ms 1 Yes /classes/SpecificPrice.php:576
569 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4418
AND image_shop.`cover` = 1 LIMIT 1
 0.659 ms 1 /classes/Product.php:3570
299 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 996
ORDER BY f.position ASC
 0.653 ms 1 Yes /classes/Product.php:6024
418 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 4464 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.652 ms 1 Yes /classes/SpecificPrice.php:576
295 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 996 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 996 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.650 ms 0 /classes/Cart.php:1430
709 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4397 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4397 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.648 ms 0 /classes/Cart.php:1430
334 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 999
AND image_shop.`cover` = 1 LIMIT 1
 0.645 ms 1 /classes/Product.php:3570
685 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 4398 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.645 ms 1 Yes /classes/SpecificPrice.php:576
495 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4435 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4435 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.644 ms 0 /classes/Cart.php:1430
162 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 972
AND image_shop.`cover` = 1 LIMIT 1
 0.643 ms 3 /classes/Product.php:3570
711 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 5215
AND cp.`id_cart` = 0 AND cp.`id_product` = 4397 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 5215
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4397 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.643 ms 0 /classes/Cart.php:1430
191 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 985 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.639 ms 1 Yes /classes/SpecificPrice.php:576
256 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 991 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 991 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.639 ms 0 /classes/Cart.php:1430
797 
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (5214, 5215) AND il.`id_lang` = 2 ORDER by i.`position`
 0.639 ms 1 Yes /classes/Product.php:2915
160 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 971 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 971 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.633 ms 0 /classes/Cart.php:1430
487 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4435) AND (b.`id_shop` = 1) LIMIT 1
 0.630 ms 1 /src/Adapter/EntityMapper.php:71
720 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 4390 LIMIT 1
 0.629 ms 1 /classes/SpecificPrice.php:435
296 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 996) AND (id_product_attribute = 1791) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.626 ms 1 /classes/stock/StockAvailable.php:453
533 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4421
AND image_shop.`cover` = 1 LIMIT 1
 0.625 ms 1 /classes/Product.php:3570
387 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1014 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.624 ms 1 Yes /classes/SpecificPrice.php:576
372 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1013) AND (b.`id_shop` = 1) LIMIT 1
 0.622 ms 1 /src/Adapter/EntityMapper.php:71
583 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4417) AND (b.`id_shop` = 1) LIMIT 1
 0.622 ms 1 /src/Adapter/EntityMapper.php:71
609 
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `prstshp_attribute` a
LEFT JOIN `prstshp_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 2)
LEFT JOIN `prstshp_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `prstshp_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 2)
LEFT JOIN `prstshp_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 2)
WHERE pa.`id_product` = 4414
AND pac.`id_product_attribute` = 5236
AND agl.`id_lang` = 2
 0.622 ms 2 /classes/Product.php:7528
779 
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (5226) AND il.`id_lang` = 2 ORDER by i.`position`
 0.621 ms 1 Yes /classes/Product.php:2915
244 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 990 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 990 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.620 ms 0 /classes/Cart.php:1430
398 
SELECT SQL_NO_CACHE c.*, cl.*
FROM `prstshp_category` c
LEFT JOIN `prstshp_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 2 AND cl.id_shop = 1 )
WHERE `name` = 'JOYAS DE ORO'
AND c.`id_category` != 2
AND c.`id_parent` = 2 LIMIT 1
 0.617 ms 2 /classes/Category.php:1492
510 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.617 ms 1 /classes/Product.php:5670
447 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4462 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4462 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.616 ms 0 /classes/Cart.php:1430
652 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 4400
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.616 ms 0 /classes/SpecificPrice.php:256
137 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 969
ORDER BY f.position ASC
 0.613 ms 1 Yes /classes/Product.php:6024
719 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4390) AND (b.`id_shop` = 1) LIMIT 1
 0.610 ms 1 /src/Adapter/EntityMapper.php:71
532 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4422
ORDER BY f.position ASC
 0.609 ms 1 Yes /classes/Product.php:6024
701 
SELECT SQL_NO_CACHE product_attribute_shop.`price`
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.`id_product_attribute` = 5215 LIMIT 1
 0.608 ms 1 /classes/Combination.php:560
188 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 985) AND (b.`id_shop` = 1) LIMIT 1
 0.607 ms 1 /src/Adapter/EntityMapper.php:71
836 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4414) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
 0.607 ms 3 Yes /classes/Product.php:4513
59 
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 115) AND (b.`id_shop` = 1) LIMIT 1
 0.604 ms 1 /src/Adapter/EntityMapper.php:71
651 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 4400 LIMIT 1
 0.602 ms 1 /classes/SpecificPrice.php:435
735 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 4462
ORDER BY `position`
 0.602 ms 1 Yes /classes/Product.php:3539
173 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 972
ORDER BY f.position ASC
 0.600 ms 1 Yes /classes/Product.php:6024
180 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 975)
 0.599 ms 1 /classes/Product.php:3860
275 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 993 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.595 ms 1 Yes /classes/SpecificPrice.php:576
664 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 4399 LIMIT 1
 0.590 ms 1 /classes/SpecificPrice.php:435
845 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4399) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
 0.589 ms 2 Yes /classes/Product.php:4513
367 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1012) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.589 ms 1 /classes/stock/StockAvailable.php:453
484 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4452
ORDER BY f.position ASC
 0.588 ms 1 Yes /classes/Product.php:6024
51 
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 68) AND (b.`id_shop` = 1) LIMIT 1
 0.587 ms 1 /src/Adapter/EntityMapper.php:71
694 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4398
ORDER BY f.position ASC
 0.585 ms 1 Yes /classes/Product.php:6024
203 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 986 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.584 ms 1 Yes /classes/SpecificPrice.php:576
641 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 4403 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.583 ms 1 Yes /classes/SpecificPrice.php:576
519 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4423 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4423 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.579 ms 0 /classes/Cart.php:1430
81 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `prstshp_category_lang` cl
WHERE `id_lang` = 2
AND cl.id_shop = 1 
AND cl.`id_category` = 15 LIMIT 1
 0.578 ms 1 /classes/Category.php:1373
671 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4399 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4399 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.576 ms 0 /classes/Cart.php:1430
855 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4397) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
 0.576 ms 2 Yes /classes/Product.php:4513
41 
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 14) AND (b.`id_shop` = 1) LIMIT 1
 0.575 ms 1 /src/Adapter/EntityMapper.php:71
752 
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (5253) AND il.`id_lang` = 2 ORDER by i.`position`
 0.574 ms 1 Yes /classes/Product.php:2915
148 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 970 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 970 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.572 ms 0 /classes/Cart.php:1430
290 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 996)
 0.569 ms 2 /classes/Product.php:3860
186 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 985
AND image_shop.`cover` = 1 LIMIT 1
 0.569 ms 1 /classes/Product.php:3570
563 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4419)
 0.569 ms 1 /classes/Product.php:3860
485 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4435
AND image_shop.`cover` = 1 LIMIT 1
 0.568 ms 2 /classes/Product.php:3570
498 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.564 ms 1 /classes/Product.php:5670
850 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4398) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
 0.562 ms 2 Yes /classes/Product.php:4513
658 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4400 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4400 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.561 ms 0 /classes/Cart.php:1430
147 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 970) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.558 ms 1 /classes/stock/StockAvailable.php:453
770 
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (5241) AND il.`id_lang` = 2 ORDER by i.`position`
 0.558 ms 1 Yes /classes/Product.php:2915
657 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 4400) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.556 ms 1 /classes/stock/StockAvailable.php:453
741 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 4457
ORDER BY `position`
 0.556 ms 1 Yes /classes/Product.php:3539
436 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4463
ORDER BY f.position ASC
 0.554 ms 1 Yes /classes/Product.php:6024
748 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 4435
 0.553 ms 1 /classes/Product.php:2899
648 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4400
AND image_shop.`cover` = 1 LIMIT 1
 0.551 ms 5 /classes/Product.php:3570
668 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 4399 AND id_shop=1 LIMIT 1
 0.551 ms 1 /classes/Product.php:6884
738 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 4459
ORDER BY `position`
 0.551 ms 1 Yes /classes/Product.php:3539
274 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 993
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.546 ms 0 /classes/SpecificPrice.php:256
663 
SELECT SQL_NO_CACHE product_attribute_shop.`price`
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.`id_product_attribute` = 5219 LIMIT 1
 0.546 ms 1 /classes/Combination.php:560
856 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4390) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
 0.546 ms 1 Yes /classes/Product.php:4513
740 
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (5282) AND il.`id_lang` = 2 ORDER by i.`position`
 0.545 ms 1 Yes /classes/Product.php:2915
746 
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (5275) AND il.`id_lang` = 2 ORDER by i.`position`
 0.544 ms 1 Yes /classes/Product.php:2915
509 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4423
AND image_shop.`cover` = 1 LIMIT 1
 0.543 ms 1 /classes/Product.php:3570
300 
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `prstshp_attribute` a
LEFT JOIN `prstshp_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 2)
LEFT JOIN `prstshp_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `prstshp_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 2)
LEFT JOIN `prstshp_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 2)
WHERE pa.`id_product` = 996
AND pac.`id_product_attribute` = 1791
AND agl.`id_lang` = 2
 0.541 ms 2 /classes/Product.php:7528
684 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 4398
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.541 ms 1 /classes/SpecificPrice.php:256
721 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 4390
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.540 ms 0 /classes/SpecificPrice.php:256
710 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 4397) AND (id_product_attribute = 5215) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.537 ms 1 /classes/stock/StockAvailable.php:453
289 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 996 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.536 ms 1 Yes /classes/SpecificPrice.php:576
74 
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module` WHERE `name` = "ps_accounts" LIMIT 1
 0.533 ms 1 /src/Adapter/Module/ModuleDataProvider.php:256
414 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4464) AND (b.`id_shop` = 1) LIMIT 1
 0.533 ms 1 /src/Adapter/EntityMapper.php:71
722 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 4390 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.533 ms 1 Yes /classes/SpecificPrice.php:576
700 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4397) AND (b.`id_shop` = 1) LIMIT 1
 0.531 ms 1 /src/Adapter/EntityMapper.php:71
114 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 967 LIMIT 1
 0.530 ms 1 /classes/SpecificPrice.php:435
161 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 971
ORDER BY f.position ASC
 0.530 ms 1 Yes /classes/Product.php:6024
591 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4417 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4417 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.528 ms 0 /classes/Cart.php:1430
115 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE `id_product` != 0 LIMIT 1
 0.526 ms 1809 /classes/SpecificPrice.php:297
660 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4399
AND image_shop.`cover` = 1 LIMIT 1
 0.521 ms 5 /classes/Product.php:3570
324 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 998) AND (b.`id_shop` = 1) LIMIT 1
 0.520 ms 1 /src/Adapter/EntityMapper.php:71
704 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 4397 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.520 ms 1 Yes /classes/SpecificPrice.php:576
580 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4418
ORDER BY f.position ASC
 0.518 ms 1 Yes /classes/Product.php:6024
215 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 987 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.517 ms 1 Yes /classes/SpecificPrice.php:576
164 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 972) AND (b.`id_shop` = 1) LIMIT 1
 0.512 ms 1 /src/Adapter/EntityMapper.php:71
208 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 986 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 986 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.511 ms 0 /classes/Cart.php:1430
540 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 4421 AND id_shop=1 LIMIT 1
 0.511 ms 1 /classes/Product.php:6884
378 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1013 AND `id_group` = 1 LIMIT 1
 0.510 ms 0 /classes/GroupReduction.php:153
655 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 4400 AND id_shop=1 LIMIT 1
 0.510 ms 1 /classes/Product.php:6884
391 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1014) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.507 ms 1 /classes/stock/StockAvailable.php:453
282 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 996
AND image_shop.`cover` = 1 LIMIT 1
 0.503 ms 1 /classes/Product.php:3570
136 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 969 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 969 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.501 ms 0 /classes/Cart.php:1430
736 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 4462
 0.500 ms 1 /classes/Product.php:2899
76 
SELECT SQL_NO_CACHE `id_configuration`
FROM `prstshp_configuration`
WHERE name = 'PS_ACCOUNTS_SHOP_STATUS'
AND (id_shop_group IS NULL OR id_shop_group = 0) AND (id_shop IS NULL OR id_shop = 0) LIMIT 1
 0.499 ms 1 /classes/Configuration.php:133
383 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.496 ms 1 /classes/Product.php:5670
749 
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (5258) AND il.`id_lang` = 2 ORDER by i.`position`
 0.496 ms 1 Yes /classes/Product.php:2915
253 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 991 AND id_shop=1 LIMIT 1
 0.494 ms 1 /classes/Product.php:6884
617 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 4406 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.494 ms 1 Yes /classes/SpecificPrice.php:576
596 
SELECT SQL_NO_CACHE product_attribute_shop.`price`
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.`id_product_attribute` = 5236 LIMIT 1
 0.492 ms 1 /classes/Combination.php:560
84 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 0 LIMIT 1
 0.491 ms 1 /classes/SpecificPrice.php:426
156 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 971)
 0.488 ms 1 /classes/Product.php:3860
514 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 4423 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.488 ms 1 Yes /classes/SpecificPrice.php:576
305 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 997) AND (b.`id_shop` = 1) LIMIT 1
 0.486 ms 1 /src/Adapter/EntityMapper.php:71
603 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 4414) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.483 ms 1 /classes/stock/StockAvailable.php:453
622 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4406 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4406 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.483 ms 0 /classes/Cart.php:1430
430 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 4463 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.482 ms 1 Yes /classes/SpecificPrice.php:576
379 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1013) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.482 ms 1 /classes/stock/StockAvailable.php:453
661 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.480 ms 1 /classes/Product.php:5670
82 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 15 LIMIT 1
 0.478 ms 1 /classes/Product.php:5670
248 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 991) AND (b.`id_shop` = 1) LIMIT 1
 0.478 ms 1 /src/Adapter/EntityMapper.php:71
454 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 4459 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.478 ms 1 Yes /classes/SpecificPrice.php:576
530 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 4422) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.478 ms 1 /classes/stock/StockAvailable.php:453
608 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4414
ORDER BY f.position ASC
 0.478 ms 1 Yes /classes/Product.php:6024
653 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 4400 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.478 ms 1 Yes /classes/SpecificPrice.php:576
130 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 969
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.477 ms 0 /classes/SpecificPrice.php:256
627 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 4404 LIMIT 1
 0.477 ms 1 /classes/SpecificPrice.php:435
451 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4459) AND (b.`id_shop` = 1) LIMIT 1
 0.476 ms 1 /src/Adapter/EntityMapper.php:71
592 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4417
ORDER BY f.position ASC
 0.475 ms 1 Yes /classes/Product.php:6024
575 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4418)
 0.472 ms 1 /classes/Product.php:3860
177 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 975 LIMIT 1
 0.467 ms 1 /classes/SpecificPrice.php:435
354 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1009 AND `id_group` = 1 LIMIT 1
 0.467 ms 0 /classes/GroupReduction.php:153
605 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 4414) AND (id_product_attribute = 5236) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.467 ms 1 /classes/stock/StockAvailable.php:453
157 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 971 AND id_shop=1 LIMIT 1
 0.467 ms 1 /classes/Product.php:6884
623 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4406
ORDER BY f.position ASC
 0.466 ms 1 Yes /classes/Product.php:6024
426 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.465 ms 1 /classes/Product.php:5670
571 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4418) AND (b.`id_shop` = 1) LIMIT 1
 0.464 ms 1 /src/Adapter/EntityMapper.php:71
292 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 996 AND `id_group` = 1 LIMIT 1
 0.463 ms 0 /classes/GroupReduction.php:153
507 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4430 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4430 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.463 ms 0 /classes/Cart.php:1430
680 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.457 ms 1 /classes/Product.php:5670
771 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 4417
ORDER BY `position`
 0.453 ms 1 Yes /classes/Product.php:3539
567 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4419 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4419 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.451 ms 0 /classes/Cart.php:1430
338 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 999
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.448 ms 0 /classes/SpecificPrice.php:256
154 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 971
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.447 ms 0 /classes/SpecificPrice.php:256
649 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.446 ms 1 /classes/Product.php:5670
717 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4390
AND image_shop.`cover` = 1 LIMIT 1
 0.446 ms 1 /classes/Product.php:3570
442 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 4462 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.444 ms 1 Yes /classes/SpecificPrice.php:576
574 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 4418 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.442 ms 1 Yes /classes/SpecificPrice.php:576
588 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 4417 AND id_shop=1 LIMIT 1
 0.442 ms 1 /classes/Product.php:6884
190 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 985
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.441 ms 0 /classes/SpecificPrice.php:256
628 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 4404
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.441 ms 0 /classes/SpecificPrice.php:256
159 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 971) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.439 ms 1 /classes/stock/StockAvailable.php:453
272 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 993) AND (b.`id_shop` = 1) LIMIT 1
 0.438 ms 1 /src/Adapter/EntityMapper.php:71
187 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.437 ms 1 /classes/Product.php:5670
543 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4421 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4421 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.433 ms 0 /classes/Cart.php:1430
768 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 4418
ORDER BY `position`
 0.433 ms 1 Yes /classes/Product.php:3539
96 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 948) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.431 ms 1 /classes/stock/StockAvailable.php:453
304 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.430 ms 1 /classes/Product.php:5670
355 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1009) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.429 ms 1 /classes/stock/StockAvailable.php:453
578 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 4418) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.429 ms 1 /classes/stock/StockAvailable.php:453
703 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 4397
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.428 ms 0 /classes/SpecificPrice.php:256
743 
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (5280) AND il.`id_lang` = 2 ORDER by i.`position`
 0.428 ms 1 Yes /classes/Product.php:2915
737 
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (5285) AND il.`id_lang` = 2 ORDER by i.`position`
 0.427 ms 1 Yes /classes/Product.php:2915
789 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 4399
ORDER BY `position`
 0.427 ms 5 Yes /classes/Product.php:3539
178 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 975
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.426 ms 0 /classes/SpecificPrice.php:256
181 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 975 AND id_shop=1 LIMIT 1
 0.426 ms 1 /classes/Product.php:6884
682 
SELECT SQL_NO_CACHE product_attribute_shop.`price`
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.`id_product_attribute` = 6947 LIMIT 1
 0.425 ms 1 /classes/Combination.php:560
629 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 4404 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.423 ms 1 Yes /classes/SpecificPrice.php:576
776 
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (5234, 5236, 5237) AND il.`id_lang` = 2 ORDER by i.`position`
 0.423 ms 1 Yes /classes/Product.php:2915
163 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.421 ms 1 /classes/Product.php:5670
220 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 987 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 987 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.420 ms 0 /classes/Cart.php:1430
423 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4464 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4464 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.420 ms 0 /classes/Cart.php:1430
478 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 4452 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.416 ms 1 Yes /classes/SpecificPrice.php:576
448 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4462
ORDER BY f.position ASC
 0.416 ms 1 Yes /classes/Product.php:6024
350 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1009
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.412 ms 0 /classes/SpecificPrice.php:256
613 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.411 ms 1 /classes/Product.php:5670
455 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4459)
 0.410 ms 1 /classes/Product.php:3860
466 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 4457 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.408 ms 1 Yes /classes/SpecificPrice.php:576
724 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 4390 AND id_shop=1 LIMIT 1
 0.408 ms 1 /classes/Product.php:6884
286 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 996 LIMIT 1
 0.407 ms 1 /classes/SpecificPrice.php:435
335 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.407 ms 1 /classes/Product.php:5670
165 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 972 LIMIT 1
 0.405 ms 1 /classes/SpecificPrice.php:435
640 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 4403
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.404 ms 0 /classes/SpecificPrice.php:256
614 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4406) AND (b.`id_shop` = 1) LIMIT 1
 0.404 ms 1 /src/Adapter/EntityMapper.php:71
683 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 4398 LIMIT 1
 0.403 ms 1 /classes/SpecificPrice.php:435
742 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 4457
 0.403 ms 1 /classes/Product.php:2899
166 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 972
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.402 ms 0 /classes/SpecificPrice.php:256
550 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 4420 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.402 ms 1 Yes /classes/SpecificPrice.php:576
781 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 4404
 0.402 ms 1 /classes/Product.php:2899
123 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 967) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.400 ms 1 /classes/stock/StockAvailable.php:453
539 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4421)
 0.398 ms 1 /classes/Product.php:3860
287 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE `id_product_attribute` != 0 LIMIT 1
 0.396 ms 2 /classes/SpecificPrice.php:297
269 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 992
ORDER BY f.position ASC
 0.395 ms 1 Yes /classes/Product.php:6024
482 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 4452) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.394 ms 1 /classes/stock/StockAvailable.php:453
644 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 4403 AND `id_group` = 1 LIMIT 1
 0.394 ms 0 /classes/GroupReduction.php:153
169 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 972 AND id_shop=1 LIMIT 1
 0.393 ms 1 /classes/Product.php:6884
697 
SELECT SQL_NO_CACHE *
FROM `prstshp_product_attribute_lang`
WHERE `id_product_attribute` = 6947
 0.393 ms 2 /src/Adapter/EntityMapper.php:79
174 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 975
AND image_shop.`cover` = 1 LIMIT 1
 0.392 ms 3 /classes/Product.php:3570
413 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.392 ms 1 /classes/Product.php:5670
698 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4397
AND image_shop.`cover` = 1 LIMIT 1
 0.390 ms 5 /classes/Product.php:3570
739 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 4459
 0.389 ms 1 /classes/Product.php:2899
707 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 4397 AND `id_group` = 1 LIMIT 1
 0.388 ms 0 /classes/GroupReduction.php:153
788 
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (5220) AND il.`id_lang` = 2 ORDER by i.`position`
 0.387 ms 1 Yes /classes/Product.php:2915
8 
SELECT SQL_NO_CACHE *
FROM `prstshp_lang` a
LEFT JOIN `prstshp_lang_shop` `c` ON a.`id_lang` = c.`id_lang` AND c.`id_shop` = 1
WHERE (a.`id_lang` = 2) LIMIT 1
 0.387 ms 1 /src/Adapter/EntityMapper.php:71
586 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 4417 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.387 ms 1 Yes /classes/SpecificPrice.php:576
620 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 4406 AND `id_group` = 1 LIMIT 1
 0.384 ms 0 /classes/GroupReduction.php:153
564 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 4419 AND id_shop=1 LIMIT 1
 0.383 ms 1 /classes/Product.php:6884
262 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 992
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.382 ms 0 /classes/SpecificPrice.php:256
518 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 4423) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.381 ms 1 /classes/stock/StockAvailable.php:453
212 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 987) AND (b.`id_shop` = 1) LIMIT 1
 0.380 ms 1 /src/Adapter/EntityMapper.php:71
227 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 989 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.380 ms 1 Yes /classes/SpecificPrice.php:576
384 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1014) AND (b.`id_shop` = 1) LIMIT 1
 0.379 ms 1 /src/Adapter/EntityMapper.php:71
871 
SELECT SQL_NO_CACHE m.* FROM `prstshp_module` m
 0.378 ms 102 /classes/module/Module.php:1724
232 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 989 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 989 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.377 ms 0 /classes/Cart.php:1430
259 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.377 ms 1 /classes/Product.php:5670
662 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4399) AND (b.`id_shop` = 1) LIMIT 1
 0.376 ms 1 /src/Adapter/EntityMapper.php:71
764 
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (5243) AND il.`id_lang` = 2 ORDER by i.`position`
 0.376 ms 1 Yes /classes/Product.php:2915
834 
SELECT SQL_NO_CACHE pac.id_product_attribute, GROUP_CONCAT(agl.`name`, ' - ',al.`name` ORDER BY agl.`id_attribute_group` SEPARATOR ', ') as attribute_designation
FROM `prstshp_product_attribute_combination` pac
LEFT JOIN `prstshp_attribute` a ON a.`id_attribute` = pac.`id_attribute`
LEFT JOIN `prstshp_attribute_group` ag ON ag.`id_attribute_group` = a.`id_attribute_group`
LEFT JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
LEFT JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 2)
WHERE pac.id_product_attribute IN (5236,5237)
GROUP BY pac.id_product_attribute
ORDER BY pac.id_product_attribute
 0.374 ms 4 /classes/Product.php:2746
566 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 4419) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.373 ms 1 /classes/stock/StockAvailable.php:453
643 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 4403 AND id_shop=1 LIMIT 1
 0.372 ms 1 /classes/Product.php:6884
71 
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a0
LEFT JOIN `prstshp_category_lang` `a1` ON (a0.`id_category` = a1.`id_category`)
WHERE (a0.`nleft` < 2) AND (a0.`nright` > 197) AND (a1.`id_lang` = 2) AND (a1.`id_shop` = 1)
ORDER BY a0.`nleft` asc
 0.371 ms 1 /classes/PrestaShopCollection.php:383
607 
SELECT SQL_NO_CACHE pa.`available_date` FROM `prstshp_product` p LEFT JOIN `prstshp_product_attribute` pa ON (pa.`id_product` = p.`id_product`) INNER JOIN prstshp_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1) INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) WHERE p.`id_product` = 4414 AND pa.`id_product` = 4414 AND pa.`id_product_attribute` = 5236 LIMIT 1
 0.369 ms 1 /classes/Product.php:1209
718 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.369 ms 1 /classes/Product.php:5670
475 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4452) AND (b.`id_shop` = 1) LIMIT 1
 0.367 ms 1 /src/Adapter/EntityMapper.php:71
55 
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 93) AND (b.`id_shop` = 1) LIMIT 1
 0.364 ms 1 /src/Adapter/EntityMapper.php:71
565 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 4419 AND `id_group` = 1 LIMIT 1
 0.362 ms 0 /classes/GroupReduction.php:153
538 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 4421 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.362 ms 1 Yes /classes/SpecificPrice.php:576
844 
SELECT SQL_NO_CACHE pac.id_product_attribute, GROUP_CONCAT(agl.`name`, ' - ',al.`name` ORDER BY agl.`id_attribute_group` SEPARATOR ', ') as attribute_designation
FROM `prstshp_product_attribute_combination` pac
LEFT JOIN `prstshp_attribute` a ON a.`id_attribute` = pac.`id_attribute`
LEFT JOIN `prstshp_attribute_group` ag ON ag.`id_attribute_group` = a.`id_attribute_group`
LEFT JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
LEFT JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 2)
WHERE pac.id_product_attribute IN (5219)
GROUP BY pac.id_product_attribute
ORDER BY pac.id_product_attribute
 0.361 ms 2 /classes/Product.php:2746
725 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 4390 AND `id_group` = 1 LIMIT 1
 0.360 ms 0 /classes/GroupReduction.php:153
800 
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (5199) AND il.`id_lang` = 2 ORDER by i.`position`
 0.358 ms 1 Yes /classes/Product.php:2915
424 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4464
ORDER BY f.position ASC
 0.356 ms 1 Yes /classes/Product.php:6024
472 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4457
ORDER BY f.position ASC
 0.355 ms 1 Yes /classes/Product.php:6024
343 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 999) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.352 ms 1 /classes/stock/StockAvailable.php:453
854 
SELECT SQL_NO_CACHE pac.id_product_attribute, GROUP_CONCAT(agl.`name`, ' - ',al.`name` ORDER BY agl.`id_attribute_group` SEPARATOR ', ') as attribute_designation
FROM `prstshp_product_attribute_combination` pac
LEFT JOIN `prstshp_attribute` a ON a.`id_attribute` = pac.`id_attribute`
LEFT JOIN `prstshp_attribute_group` ag ON ag.`id_attribute_group` = a.`id_attribute_group`
LEFT JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
LEFT JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 2)
WHERE pac.id_product_attribute IN (5215)
GROUP BY pac.id_product_attribute
ORDER BY pac.id_product_attribute
 0.352 ms 2 /classes/Product.php:2746
7 
SELECT SQL_NO_CACHE *
FROM `prstshp_shop_group` a
WHERE (a.`id_shop_group` = 1) LIMIT 1
 0.351 ms 1 /src/Adapter/EntityMapper.php:71
786 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 4400
ORDER BY `position`
 0.351 ms 5 Yes /classes/Product.php:3539
599 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 4414 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.349 ms 1 Yes /classes/SpecificPrice.php:576
699 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.349 ms 1 /classes/Product.php:5670
399 
SELECT SQL_NO_CACHE c.*, cl.*
FROM `prstshp_category` c
LEFT JOIN `prstshp_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 2 AND cl.id_shop = 1 )
WHERE `name` = 'JOYAS DE PLATA'
AND c.`id_category` != 2
AND c.`id_parent` = 2 LIMIT 1
 0.349 ms 2 /classes/Category.php:1492
146 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 970 AND `id_group` = 1 LIMIT 1
 0.346 ms 0 /classes/GroupReduction.php:153
239 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 990 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.346 ms 1 Yes /classes/SpecificPrice.php:576
766 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 4419
 0.346 ms 1 /classes/Product.php:2899
650 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4400) AND (b.`id_shop` = 1) LIMIT 1
 0.345 ms 1 /src/Adapter/EntityMapper.php:71
197 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 985
ORDER BY f.position ASC
 0.344 ms 1 Yes /classes/Product.php:6024
508 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4430
ORDER BY f.position ASC
 0.343 ms 1 Yes /classes/Product.php:6024
804 
SELECT SQL_NO_CACHE 1 FROM `prstshp_cart_rule` WHERE ((date_to >= "2026-04-13 00:00:00" AND date_to <= "2026-04-13 23:59:59") OR (date_from >= "2026-04-13 00:00:00" AND date_from <= "2026-04-13 23:59:59") OR (date_from < "2026-04-13 00:00:00" AND date_to > "2026-04-13 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
 0.342 ms 7 /classes/CartRule.php:357
526 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 4422 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.341 ms 1 Yes /classes/SpecificPrice.php:576
87 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 948 AND id_shop=1 LIMIT 1
 0.341 ms 1 /classes/Product.php:6884
209 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 986
ORDER BY f.position ASC
 0.340 ms 1 Yes /classes/Product.php:6024
777 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 4406
ORDER BY `position`
 0.340 ms 4 Yes /classes/Product.php:3539
796 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 4397
 0.339 ms 2 /classes/Product.php:2899
221 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 987
ORDER BY f.position ASC
 0.337 ms 1 Yes /classes/Product.php:6024
511 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4423) AND (b.`id_shop` = 1) LIMIT 1
 0.337 ms 1 /src/Adapter/EntityMapper.php:71
182 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 975 AND `id_group` = 1 LIMIT 1
 0.333 ms 0 /classes/GroupReduction.php:153
427 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4463) AND (b.`id_shop` = 1) LIMIT 1
 0.333 ms 1 /src/Adapter/EntityMapper.php:71
604 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4414 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4414 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.333 ms 0 /classes/Cart.php:1430
521 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4422
AND image_shop.`cover` = 1 LIMIT 1
 0.332 ms 1 /classes/Product.php:3570
853 
SELECT SQL_NO_CACHE pa.*, product_attribute_shop.*
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 4397
GROUP BY pa.`id_product_attribute`
ORDER BY pa.`id_product_attribute`
 0.331 ms 2 Yes Yes /classes/Product.php:2731
101 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 15 LIMIT 1
 0.331 ms 1 /classes/Product.php:5670
785 
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (5223) AND il.`id_lang` = 2 ORDER by i.`position`
 0.331 ms 1 Yes /classes/Product.php:2915
460 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4459
ORDER BY f.position ASC
 0.330 ms 1 Yes /classes/Product.php:6024
366 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1012 AND `id_group` = 1 LIMIT 1
 0.329 ms 0 /classes/GroupReduction.php:153
830 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4414) LIMIT 1
 0.329 ms 1 /src/Adapter/EntityMapper.php:71
849 
SELECT SQL_NO_CACHE pac.id_product_attribute, GROUP_CONCAT(agl.`name`, ' - ',al.`name` ORDER BY agl.`id_attribute_group` SEPARATOR ', ') as attribute_designation
FROM `prstshp_product_attribute_combination` pac
LEFT JOIN `prstshp_attribute` a ON a.`id_attribute` = pac.`id_attribute`
LEFT JOIN `prstshp_attribute_group` ag ON ag.`id_attribute_group` = a.`id_attribute_group`
LEFT JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
LEFT JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 2)
WHERE pac.id_product_attribute IN (6947)
GROUP BY pac.id_product_attribute
ORDER BY pac.id_product_attribute
 0.328 ms 2 /classes/Product.php:2746
606 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 5236
AND cp.`id_cart` = 0 AND cp.`id_product` = 4414 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 5236
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4414 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.326 ms 0 /classes/Cart.php:1430
465 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 4457
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.324 ms 0 /classes/SpecificPrice.php:256
587 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4417)
 0.324 ms 1 /classes/Product.php:3860
77 
SELECT SQL_NO_CACHE *
FROM `prstshp_configuration` a
WHERE (a.`id_configuration` = 1315) LIMIT 1
 0.323 ms 1 /src/Adapter/EntityMapper.php:71
0 
SELECT SQL_NO_CACHE s.id_shop, CONCAT(su.physical_uri, su.virtual_uri) AS uri, su.domain, su.main
FROM prstshp_shop_url su
LEFT JOIN prstshp_shop s ON (s.id_shop = su.id_shop)
WHERE (su.domain = 'www.joieriaorfi.es' OR su.domain_ssl = 'www.joieriaorfi.es')
AND s.active = 1
AND s.deleted = 0
ORDER BY LENGTH(CONCAT(su.physical_uri, su.virtual_uri)) DESC
 0.321 ms 1 Yes /classes/shop/Shop.php:1364
471 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4457 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4457 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.319 ms 0 /classes/Cart.php:1430
555 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4420 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4420 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.319 ms 0 /classes/Cart.php:1430
626 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4404) AND (b.`id_shop` = 1) LIMIT 1
 0.319 ms 1 /src/Adapter/EntityMapper.php:71
765 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 4419
ORDER BY `position`
 0.318 ms 1 Yes /classes/Product.php:3539
250 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 991
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.317 ms 0 /classes/SpecificPrice.php:256
610 
SELECT SQL_NO_CACHE *
FROM `prstshp_product_attribute` a
LEFT JOIN `prstshp_product_attribute_shop` `c` ON a.`id_product_attribute` = c.`id_product_attribute` AND c.`id_shop` = 1
WHERE (a.`id_product_attribute` = 5236) LIMIT 1
 0.317 ms 1 /src/Adapter/EntityMapper.php:71
577 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 4418 AND `id_group` = 1 LIMIT 1
 0.315 ms 0 /classes/GroupReduction.php:153
435 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4463 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4463 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.313 ms 0 /classes/Cart.php:1430
726 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 4390) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.313 ms 1 /classes/stock/StockAvailable.php:453
494 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 4435) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.313 ms 1 /classes/stock/StockAvailable.php:453
493 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 4435 AND `id_group` = 1 LIMIT 1
 0.312 ms 0 /classes/GroupReduction.php:153
759 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 4421
ORDER BY `position`
 0.311 ms 1 Yes /classes/Product.php:3539
811 
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module_shop` WHERE `id_module` = 17 AND `id_shop` = 1 LIMIT 1
 0.310 ms 1 /classes/module/Module.php:2137
62 
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module` WHERE `name` = "ps_legalcompliance" LIMIT 1
 0.309 ms 0 /classes/module/Module.php:2664
459 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4459 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4459 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.308 ms 0 /classes/Cart.php:1430
56 
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 112) AND (b.`id_shop` = 1) LIMIT 1
 0.308 ms 1 /src/Adapter/EntityMapper.php:71
121 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 967 AND id_shop=1 LIMIT 1
 0.307 ms 1 /classes/Product.php:6884
734 
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (5286) AND il.`id_lang` = 2 ORDER by i.`position`
 0.307 ms 1 Yes /classes/Product.php:2915
833 
SELECT SQL_NO_CACHE pa.*, product_attribute_shop.*
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 4414
GROUP BY pa.`id_product_attribute`
ORDER BY pa.`id_product_attribute`
 0.306 ms 3 Yes Yes /classes/Product.php:2731
73 
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module_shop` WHERE `id_module` = 61 AND `id_shop` = 1 LIMIT 1
 0.304 ms 1 /classes/module/Module.php:2137
204 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 986)
 0.304 ms 1 /classes/Product.php:3860
848 
SELECT SQL_NO_CACHE pa.*, product_attribute_shop.*
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 4398
GROUP BY pa.`id_product_attribute`
ORDER BY pa.`id_product_attribute`
 0.304 ms 2 Yes Yes /classes/Product.php:2731
105 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 959 AND id_shop=1 LIMIT 1
 0.301 ms 1 /classes/Product.php:6884
522 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.301 ms 1 /classes/Product.php:5670
559 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4419) AND (b.`id_shop` = 1) LIMIT 1
 0.299 ms 1 /src/Adapter/EntityMapper.php:71
463 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4457) AND (b.`id_shop` = 1) LIMIT 1
 0.296 ms 1 /src/Adapter/EntityMapper.php:71
593 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4414
AND image_shop.`cover` = 1 LIMIT 1
 0.292 ms 1 /classes/Product.php:3570
192 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 985)
 0.292 ms 1 /classes/Product.php:3860
330 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 998 AND `id_group` = 1 LIMIT 1
 0.289 ms 0 /classes/GroupReduction.php:153
477 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 4452
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.288 ms 0 /classes/SpecificPrice.php:256
756 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 4422
ORDER BY `position`
 0.288 ms 1 Yes /classes/Product.php:3539
236 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 990) AND (b.`id_shop` = 1) LIMIT 1
 0.280 ms 1 /src/Adapter/EntityMapper.php:71
419 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4464)
 0.280 ms 1 /classes/Product.php:3860
630 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4404)
 0.277 ms 1 /classes/Product.php:3860
799 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 4390
 0.277 ms 1 /classes/Product.php:2899
547 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4420) AND (b.`id_shop` = 1) LIMIT 1
 0.275 ms 1 /src/Adapter/EntityMapper.php:71
573 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 4418
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.275 ms 0 /classes/SpecificPrice.php:256
731 
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (5287) AND il.`id_lang` = 2 ORDER by i.`position`
 0.275 ms 1 Yes /classes/Product.php:2915
439 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4462) AND (b.`id_shop` = 1) LIMIT 1
 0.273 ms 1 /src/Adapter/EntityMapper.php:71
597 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 4414 LIMIT 1
 0.273 ms 1 /classes/SpecificPrice.php:435
679 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4398
AND image_shop.`cover` = 1 LIMIT 1
 0.273 ms 4 /classes/Product.php:3570
233 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 989
ORDER BY f.position ASC
 0.272 ms 1 Yes /classes/Product.php:6024
544 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4421
ORDER BY f.position ASC
 0.271 ms 1 Yes /classes/Product.php:6024
78 
SELECT SQL_NO_CACHE *
FROM `prstshp_configuration_lang`
WHERE `id_configuration` = 1315
 0.269 ms 1 /src/Adapter/EntityMapper.php:79
595 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4414) AND (b.`id_shop` = 1) LIMIT 1
 0.268 ms 1 /src/Adapter/EntityMapper.php:71
535 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4421) AND (b.`id_shop` = 1) LIMIT 1
 0.267 ms 1 /src/Adapter/EntityMapper.php:71
481 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 4452 AND `id_group` = 1 LIMIT 1
 0.266 ms 0 /classes/GroupReduction.php:153
129 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 969 LIMIT 1
 0.265 ms 1 /classes/SpecificPrice.php:435
794 
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (5216, 6947) AND il.`id_lang` = 2 ORDER by i.`position`
 0.263 ms 1 Yes /classes/Product.php:2915
216 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 987)
 0.260 ms 1 /classes/Product.php:3860
224 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 989) AND (b.`id_shop` = 1) LIMIT 1
 0.260 ms 1 /src/Adapter/EntityMapper.php:71
112 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.256 ms 1 /classes/Product.php:5670
600 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4414)
 0.254 ms 2 /classes/Product.php:3860
791 
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (5218, 5219) AND il.`id_lang` = 2 ORDER by i.`position`
 0.254 ms 1 Yes /classes/Product.php:2915
63 
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.253 ms 0 /classes/module/Module.php:2137
761 
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (5244) AND il.`id_lang` = 2 ORDER by i.`position`
 0.253 ms 1 Yes /classes/Product.php:2915
401 
SELECT SQL_NO_CACHE c.*, cl.*
FROM `prstshp_category` c
LEFT JOIN `prstshp_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 2 AND cl.id_shop = 1 )
WHERE `name` = 'LATON'
AND c.`id_category` != 2
AND c.`id_parent` = 2 LIMIT 1
 0.252 ms 3 /classes/Category.php:1492
708 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 4397) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.251 ms 1 /classes/stock/StockAvailable.php:453
103 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 959 LIMIT 1
 0.249 ms 1 /classes/SpecificPrice.php:435
44 
SELECT SQL_NO_CACHE * FROM `prstshp_image_type`
 0.248 ms 8 /classes/ImageType.php:161
117 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE `to` BETWEEN '2026-04-13 00:00:00' AND '2026-04-13 23:59:59' LIMIT 1
 0.245 ms 1 /classes/SpecificPrice.php:381
470 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 4457) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.245 ms 1 /classes/stock/StockAvailable.php:453
568 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4419
ORDER BY f.position ASC
 0.245 ms 1 Yes /classes/Product.php:6024
866 
SELECT SQL_NO_CACHE `id_guest`
FROM `prstshp_connections`
WHERE `id_guest` = 1363
AND `date_add` > '2026-04-13 12:33:00'
AND id_shop IN (1) 
ORDER BY `date_add` DESC LIMIT 1
 0.243 ms 1 Yes /classes/Connection.php:168
4 
SELECT SQL_NO_CACHE su.physical_uri, su.virtual_uri, su.domain, su.domain_ssl
FROM prstshp_shop s
LEFT JOIN prstshp_shop_url su ON (s.id_shop = su.id_shop)
WHERE s.id_shop = 1
AND s.active = 1 AND s.deleted = 0 AND su.main = 1 LIMIT 1
 0.242 ms 1 /classes/shop/Shop.php:214
24 
SELECT SQL_NO_CACHE c.id_currency
FROM `prstshp_currency` c
WHERE (iso_code = 'EUR') LIMIT 1
 0.242 ms 1 /classes/Currency.php:893
624 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4404
AND image_shop.`cover` = 1 LIMIT 1
 0.238 ms 5 /classes/Product.php:3570
198 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 986
AND image_shop.`cover` = 1 LIMIT 1
 0.235 ms 1 /classes/Product.php:3570
210 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 987
AND image_shop.`cover` = 1 LIMIT 1
 0.235 ms 1 /classes/Product.php:3570
861 
SELECT SQL_NO_CACHE psgdpr.active FROM `prstshp_psgdpr_consent` psgdpr
WHERE psgdpr.id_module = 22 LIMIT 1
 0.234 ms 8 /modules/psgdpr/classes/GDPRConsent.php:130
322 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 998
AND image_shop.`cover` = 1 LIMIT 1
 0.234 ms 1 /classes/Product.php:3570
425 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4463
AND image_shop.`cover` = 1 LIMIT 1
 0.234 ms 1 /classes/Product.php:3570
65 
SELECT SQL_NO_CACHE format
FROM `prstshp_address_format`
WHERE `id_country` = 6 LIMIT 1
 0.233 ms 1 /classes/AddressFormat.php:653
556 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4420
ORDER BY f.position ASC
 0.231 ms 1 Yes /classes/Product.php:6024
158 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 971 AND `id_group` = 1 LIMIT 1
 0.230 ms 0 /classes/GroupReduction.php:153
437 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4462
AND image_shop.`cover` = 1 LIMIT 1
 0.229 ms 1 /classes/Product.php:3570
842 
SELECT SQL_NO_CACHE *
FROM `prstshp_product_lang`
WHERE `id_product` = 4399 AND `id_shop` = 1
 0.228 ms 2 /src/Adapter/EntityMapper.php:79
69 
SELECT SQL_NO_CACHE *
FROM `prstshp_state` a
WHERE (a.`id_state` = 362) LIMIT 1
 0.227 ms 1 /src/Adapter/EntityMapper.php:71
434 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 4463) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.225 ms 1 /classes/stock/StockAvailable.php:453
868 
SELECT SQL_NO_CACHE `id_page`
FROM `prstshp_page`
WHERE `id_page_type` = 5 AND `id_object` = 2 LIMIT 1
 0.224 ms 1 /classes/Page.php:83
863 
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module` WHERE `name` = "iqitcookielaw" LIMIT 1
 0.222 ms 1 /classes/module/Module.php:2664
170 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 972 AND `id_group` = 1 LIMIT 1
 0.221 ms 0 /classes/GroupReduction.php:153
473 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4452
AND image_shop.`cover` = 1 LIMIT 1
 0.218 ms 1 /classes/Product.php:3570
189 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 985 LIMIT 1
 0.217 ms 1 /classes/SpecificPrice.php:435
402 
SELECT SQL_NO_CACHE c.*, cl.*
FROM `prstshp_category` c
LEFT JOIN `prstshp_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 2 AND cl.id_shop = 1 )
WHERE `name` = 'PENDIENTES PLATA'
AND c.`id_category` != 2
AND c.`id_parent` = 2 LIMIT 1
 0.213 ms 7 /classes/Category.php:1492
631 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 4404 AND id_shop=1 LIMIT 1
 0.211 ms 1 /classes/Product.php:6884
678 
SELECT SQL_NO_CACHE *
FROM `prstshp_product_attribute_lang`
WHERE `id_product_attribute` = 5219
 0.210 ms 2 /src/Adapter/EntityMapper.php:79
790 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 4399
 0.208 ms 2 /classes/Product.php:2899
619 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 4406 AND id_shop=1 LIMIT 1
 0.207 ms 1 /classes/Product.php:6884
67 
SELECT SQL_NO_CACHE *
FROM `prstshp_country` a
LEFT JOIN `prstshp_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 6) LIMIT 1
 0.206 ms 1 /src/Adapter/EntityMapper.php:71
201 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 986 LIMIT 1
 0.206 ms 1 /classes/SpecificPrice.php:435
807 
SELECT SQL_NO_CACHE COUNT(DISTINCT c.id_currency) FROM `prstshp_currency` c
LEFT JOIN prstshp_currency_shop cs ON (cs.id_currency = c.id_currency AND cs.id_shop = 1)
WHERE c.`active` = 1 AND c.`deleted` = 0 LIMIT 1
 0.206 ms 2 /classes/Currency.php:1134
265 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 992 AND id_shop=1 LIMIT 1
 0.205 ms 1 /classes/Product.php:6884
404 
SELECT SQL_NO_CACHE c.*, cl.*
FROM `prstshp_category` c
LEFT JOIN `prstshp_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 2 AND cl.id_shop = 1 )
WHERE `name` = 'AROS'
AND c.`id_category` != 2
AND c.`id_parent` = 2 LIMIT 1
 0.204 ms 3 /classes/Category.php:1492
417 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 4464
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.203 ms 0 /classes/SpecificPrice.php:256
757 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 4422
 0.203 ms 1 /classes/Product.php:2899
403 
SELECT SQL_NO_CACHE c.*, cl.*
FROM `prstshp_category` c
LEFT JOIN `prstshp_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 2 AND cl.id_shop = 1 )
WHERE `name` = 'PENJOLL'
AND c.`id_category` != 2
AND c.`id_parent` = 2 LIMIT 1
 0.202 ms 3 /classes/Category.php:1492
527 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4422)
 0.202 ms 1 /classes/Product.php:3860
230 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 989 AND `id_group` = 1 LIMIT 1
 0.201 ms 0 /classes/GroupReduction.php:153
778 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 4406
 0.201 ms 1 /classes/Product.php:2899
422 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 4464) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.199 ms 1 /classes/stock/StockAvailable.php:453
852 
SELECT SQL_NO_CACHE *
FROM `prstshp_product_lang`
WHERE `id_product` = 4397 AND `id_shop` = 1
 0.197 ms 2 /src/Adapter/EntityMapper.php:79
758 
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (5245) AND il.`id_lang` = 2 ORDER by i.`position`
 0.195 ms 1 Yes /classes/Product.php:2915
793 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 4398
 0.195 ms 2 /classes/Product.php:2899
446 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 4462) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.193 ms 1 /classes/stock/StockAvailable.php:453
615 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 4406 LIMIT 1
 0.190 ms 1 /classes/SpecificPrice.php:435
228 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 989)
 0.189 ms 1 /classes/Product.php:3860
431 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4463)
 0.189 ms 1 /classes/Product.php:3860
572 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 4418 LIMIT 1
 0.189 ms 1 /classes/SpecificPrice.php:435
618 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4406)
 0.189 ms 1 /classes/Product.php:3860
195 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 985) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.188 ms 1 /classes/stock/StockAvailable.php:453
234 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 990
AND image_shop.`cover` = 1 LIMIT 1
 0.187 ms 1 /classes/Product.php:3570
467 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4457)
 0.186 ms 1 /classes/Product.php:3860
94 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_group`
WHERE `id_group` = 1 LIMIT 1
 0.185 ms 1 /classes/Group.php:151
452 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 4459 LIMIT 1
 0.185 ms 1 /classes/SpecificPrice.php:435
468 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 4457 AND id_shop=1 LIMIT 1
 0.185 ms 1 /classes/Product.php:6884
551 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4420)
 0.182 ms 1 /classes/Product.php:3860
443 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4462)
 0.182 ms 1 /classes/Product.php:3860
598 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 4414
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.182 ms 0 /classes/SpecificPrice.php:256
545 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4420
AND image_shop.`cover` = 1 LIMIT 1
 0.181 ms 1 /classes/Product.php:3570
449 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4459
AND image_shop.`cover` = 1 LIMIT 1
 0.180 ms 1 /classes/Product.php:3570
219 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 987) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.179 ms 1 /classes/stock/StockAvailable.php:453
222 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 989
AND image_shop.`cover` = 1 LIMIT 1
 0.179 ms 1 /classes/Product.php:3570
458 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 4459) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.179 ms 1 /classes/stock/StockAvailable.php:453
859 
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module` WHERE `name` = "ps_emailsubscription" LIMIT 1
 0.178 ms 1 /classes/module/Module.php:2664
139 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.178 ms 1 /classes/Product.php:5670
847 
SELECT SQL_NO_CACHE *
FROM `prstshp_product_lang`
WHERE `id_product` = 4398 AND `id_shop` = 1
 0.177 ms 2 /src/Adapter/EntityMapper.php:79
645 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 4403) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.177 ms 1 /classes/stock/StockAvailable.php:453
602 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 4414 AND `id_group` = 1 LIMIT 1
 0.176 ms 0 /classes/GroupReduction.php:153
133 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 969 AND id_shop=1 LIMIT 1
 0.176 ms 1 /classes/Product.php:6884
557 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4419
AND image_shop.`cover` = 1 LIMIT 1
 0.175 ms 1 /classes/Product.php:3570
745 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 4452
 0.172 ms 1 /classes/Product.php:2899
207 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 986) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.170 ms 1 /classes/stock/StockAvailable.php:453
72 
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module` WHERE `name` = "ps_facebook" LIMIT 1
 0.170 ms 1 /classes/module/Module.php:2664
450 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.170 ms 1 /classes/Product.php:5670
464 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 4457 LIMIT 1
 0.168 ms 1 /classes/SpecificPrice.php:435
5 
SELECT SQL_NO_CACHE l.*, ls.`id_shop`
FROM `prstshp_lang` l
LEFT JOIN `prstshp_lang_shop` ls ON (l.id_lang = ls.id_lang)
 0.167 ms 2 /classes/Language.php:1080
438 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.166 ms 1 /classes/Product.php:5670
461 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4457
AND image_shop.`cover` = 1 LIMIT 1
 0.165 ms 1 /classes/Product.php:3570
716 
SELECT SQL_NO_CACHE *
FROM `prstshp_product_attribute_lang`
WHERE `id_product_attribute` = 5215
 0.165 ms 2 /src/Adapter/EntityMapper.php:79
307 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 997 LIMIT 1
 0.163 ms 1 /classes/SpecificPrice.php:435
594 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.163 ms 1 /classes/Product.php:5670
581 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4417
AND image_shop.`cover` = 1 LIMIT 1
 0.162 ms 1 /classes/Product.php:3570
415 
SELECT SQL_NO_CACHE `name`
FROM `prstshp_manufacturer`
WHERE `id_manufacturer` = 17
AND `active` = 1 LIMIT 1
 0.162 ms 0 /classes/Manufacturer.php:312
582 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.162 ms 1 /classes/Product.php:5670
772 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 4417
 0.162 ms 1 /classes/Product.php:2899
862 
SELECT SQL_NO_CACHE psgdprl.message FROM `prstshp_psgdpr_consent` psgdpr
LEFT JOIN prstshp_psgdpr_consent_lang psgdprl ON (psgdpr.id_gdpr_consent = psgdprl.id_gdpr_consent)
WHERE psgdpr.id_module = 22 AND psgdprl.id_lang =2 LIMIT 1
 0.162 ms 8 /modules/psgdpr/classes/GDPRConsent.php:108
612 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4406
AND image_shop.`cover` = 1 LIMIT 1
 0.160 ms 4 /classes/Product.php:3570
867 
SELECT SQL_NO_CACHE id_page_type
FROM prstshp_page_type
WHERE name = 'category' LIMIT 1
 0.159 ms 1 /classes/Page.php:100
213 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 987 LIMIT 1
 0.158 ms 1 /classes/SpecificPrice.php:435
763 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 4420
 0.158 ms 1 /classes/Product.php:2899
457 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 4459 AND `id_group` = 1 LIMIT 1
 0.158 ms 0 /classes/GroupReduction.php:153
767 
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (5242) AND il.`id_lang` = 2 ORDER by i.`position`
 0.157 ms 1 Yes /classes/Product.php:2915
689 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 4398) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.156 ms 1 /classes/stock/StockAvailable.php:453
773 
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (5240) AND il.`id_lang` = 2 ORDER by i.`position`
 0.154 ms 1 Yes /classes/Product.php:2915
429 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 4463
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.153 ms 0 /classes/SpecificPrice.php:256
590 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 4417) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.152 ms 1 /classes/stock/StockAvailable.php:453
205 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 986 AND id_shop=1 LIMIT 1
 0.152 ms 1 /classes/Product.php:6884
751 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 4430
 0.151 ms 1 /classes/Product.php:2899
29 
SELECT SQL_NO_CACHE *
FROM `prstshp_currency` a
LEFT JOIN `prstshp_currency_lang` `b` ON a.`id_currency` = b.`id_currency` AND b.`id_lang` = 2
LEFT JOIN `prstshp_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
 0.148 ms 1 /src/Adapter/EntityMapper.php:71
702 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 4397 LIMIT 1
 0.147 ms 1 /classes/SpecificPrice.php:435
444 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 4462 AND id_shop=1 LIMIT 1
 0.147 ms 1 /classes/Product.php:6884
277 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 993 AND id_shop=1 LIMIT 1
 0.146 ms 1 /classes/Product.php:6884
858 
SELECT SQL_NO_CACHE domain,physical_uri FROM prstshp_shop_url
 0.146 ms 1 /modules/corewhatsapp/corewhatsapp.php:179
432 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 4463 AND id_shop=1 LIMIT 1
 0.145 ms 1 /classes/Product.php:6884
31 
SELECT SQL_NO_CACHE *
FROM `prstshp_currency` a
LEFT JOIN `prstshp_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 2) LIMIT 1
 0.138 ms 1 /src/Adapter/EntityMapper.php:71
560 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 4419 LIMIT 1
 0.138 ms 1 /classes/SpecificPrice.php:435
806 
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module_shop` WHERE `id_module` = 77 AND `id_shop` = 1 LIMIT 1
 0.137 ms 1 /classes/module/Module.php:2137
283 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.136 ms 1 /classes/Product.php:5670
585 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 4417
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.136 ms 0 /classes/SpecificPrice.php:256
814 
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module_shop` WHERE `id_module` = 78 AND `id_shop` = 1 LIMIT 1
 0.136 ms 1 /classes/module/Module.php:2137
809 
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module_shop` WHERE `id_module` = 27 AND `id_shop` = 1 LIMIT 1
 0.134 ms 1 /classes/module/Module.php:2137
225 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 989 LIMIT 1
 0.133 ms 1 /classes/SpecificPrice.php:435
211 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.132 ms 1 /classes/Product.php:5670
784 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 4403
 0.131 ms 1 /classes/Product.php:2899
860 
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module_shop` WHERE `id_module` = 22 AND `id_shop` = 1 LIMIT 1
 0.131 ms 1 /classes/module/Module.php:2137
706 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 4397 AND id_shop=1 LIMIT 1
 0.130 ms 1 /classes/Product.php:6884
199 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.129 ms 1 /classes/Product.php:5670
202 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 986
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.128 ms 0 /classes/SpecificPrice.php:256
235 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.126 ms 1 /classes/Product.php:5670
832 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `prstshp_category_lang` cl
WHERE `id_lang` = 0
AND cl.id_shop = 1 
AND cl.`id_category` = 18 LIMIT 1
 0.126 ms 0 /classes/Category.php:1373
231 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 989) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.126 ms 1 /classes/stock/StockAvailable.php:453
237 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 990 LIMIT 1
 0.126 ms 1 /classes/SpecificPrice.php:435
34 
SELECT SQL_NO_CACHE *
FROM `prstshp_group` a
LEFT JOIN `prstshp_group_shop` `c` ON a.`id_group` = c.`id_group` AND c.`id_shop` = 1
WHERE (a.`id_group` = 1) LIMIT 1
 0.125 ms 1 /src/Adapter/EntityMapper.php:71
217 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 987 AND id_shop=1 LIMIT 1
 0.125 ms 1 /classes/Product.php:6884
193 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 985 AND id_shop=1 LIMIT 1
 0.124 ms 1 /classes/Product.php:6884
554 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 4420) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.124 ms 1 /classes/stock/StockAvailable.php:453
665 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 4399
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.124 ms 0 /classes/SpecificPrice.php:256
428 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 4463 LIMIT 1
 0.123 ms 1 /classes/SpecificPrice.php:435
291 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 996 AND id_shop=1 LIMIT 1
 0.122 ms 1 /classes/Product.php:6884
243 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 990) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.120 ms 1 /classes/stock/StockAvailable.php:453
229 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 989 AND id_shop=1 LIMIT 1
 0.119 ms 1 /classes/Product.php:6884
656 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 4400 AND `id_group` = 1 LIMIT 1
 0.119 ms 0 /classes/GroupReduction.php:153
775 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 4414
 0.119 ms 3 /classes/Product.php:2899
342 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 999 AND `id_group` = 1 LIMIT 1
 0.118 ms 0 /classes/GroupReduction.php:153
669 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 4399 AND `id_group` = 1 LIMIT 1
 0.118 ms 0 /classes/GroupReduction.php:153
548 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 4420 LIMIT 1
 0.116 ms 1 /classes/SpecificPrice.php:435
416 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 4464 LIMIT 1
 0.115 ms 1 /classes/SpecificPrice.php:435
864 
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module_shop` WHERE `id_module` = 70 AND `id_shop` = 1 LIMIT 1
 0.115 ms 1 /classes/module/Module.php:2137
68 
SELECT SQL_NO_CACHE *
FROM `prstshp_country_lang`
WHERE `id_country` = 6
 0.114 ms 2 /src/Adapter/EntityMapper.php:79
214 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 987
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.114 ms 0 /classes/SpecificPrice.php:256
525 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 4422
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.114 ms 0 /classes/SpecificPrice.php:256
440 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 4462 LIMIT 1
 0.113 ms 1 /classes/SpecificPrice.php:435
570 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.112 ms 1 /classes/Product.php:5670
476 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 4452 LIMIT 1
 0.111 ms 1 /classes/SpecificPrice.php:435
206 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 986 AND `id_group` = 1 LIMIT 1
 0.110 ms 0 /classes/GroupReduction.php:153
218 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 987 AND `id_group` = 1 LIMIT 1
 0.109 ms 0 /classes/GroupReduction.php:153
688 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 4398 AND `id_group` = 1 LIMIT 1
 0.108 ms 0 /classes/GroupReduction.php:153
787 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 4400
 0.108 ms 1 /classes/Product.php:2899
194 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 985 AND `id_group` = 1 LIMIT 1
 0.106 ms 0 /classes/GroupReduction.php:153
546 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.106 ms 1 /classes/Product.php:5670
632 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 4404 AND `id_group` = 1 LIMIT 1
 0.105 ms 0 /classes/GroupReduction.php:153
492 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 4435 AND id_shop=1 LIMIT 1
 0.104 ms 1 /classes/Product.php:6884
37 
SELECT SQL_NO_CACHE `id_category`
FROM `prstshp_category_shop`
WHERE `id_category` = 2
AND `id_shop` = 1 LIMIT 1
 0.103 ms 1 /classes/Category.php:2446
611 
SELECT SQL_NO_CACHE *
FROM `prstshp_product_attribute_lang`
WHERE `id_product_attribute` = 5236
 0.103 ms 2 /src/Adapter/EntityMapper.php:79
760 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 4421
 0.103 ms 1 /classes/Product.php:2899
433 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 4463 AND `id_group` = 1 LIMIT 1
 0.102 ms 0 /classes/GroupReduction.php:153
462 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.102 ms 1 /classes/Product.php:5670
480 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 4452 AND id_shop=1 LIMIT 1
 0.101 ms 1 /classes/Product.php:6884
223 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.101 ms 1 /classes/Product.php:5670
241 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 990 AND id_shop=1 LIMIT 1
 0.101 ms 1 /classes/Product.php:6884
516 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 4423 AND id_shop=1 LIMIT 1
 0.100 ms 1 /classes/Product.php:6884
26 
SELECT SQL_NO_CACHE `id_lang` FROM `prstshp_lang`
WHERE `locale` = 'es-es'
OR `language_code` = 'es-es' LIMIT 1
 0.099 ms 2 /classes/Language.php:880
66 
SELECT SQL_NO_CACHE `need_identification_number`
FROM `prstshp_country`
WHERE `id_country` = 6 LIMIT 1
 0.098 ms 1 /classes/Country.php:402
534 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.098 ms 1 /classes/Product.php:5670
576 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 4418 AND id_shop=1 LIMIT 1
 0.098 ms 1 /classes/Product.php:6884
769 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 4418
 0.098 ms 1 /classes/Product.php:2899
32 
SELECT SQL_NO_CACHE *
FROM `prstshp_currency_lang`
WHERE `id_currency` = 2
 0.096 ms 2 /src/Adapter/EntityMapper.php:79
420 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 4464 AND id_shop=1 LIMIT 1
 0.096 ms 1 /classes/Product.php:6884
456 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 4459 AND id_shop=1 LIMIT 1
 0.096 ms 1 /classes/Product.php:6884
549 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 4420
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.094 ms 0 /classes/SpecificPrice.php:256
528 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 4422 AND id_shop=1 LIMIT 1
 0.093 ms 1 /classes/Product.php:6884
558 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.093 ms 1 /classes/Product.php:5670
625 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.093 ms 1 /classes/Product.php:5670
70 
SELECT SQL_NO_CACHE id_required_field, object_name, field_name
FROM prstshp_required_field
 0.092 ms 1 /classes/ObjectModel.php:1592
537 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 4421
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.092 ms 0 /classes/SpecificPrice.php:256
35 
SELECT SQL_NO_CACHE *
FROM `prstshp_group_lang`
WHERE `id_group` = 1
 0.091 ms 2 /src/Adapter/EntityMapper.php:79
505 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 4430 AND `id_group` = 1 LIMIT 1
 0.091 ms 0 /classes/GroupReduction.php:153
601 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 4414 AND id_shop=1 LIMIT 1
 0.090 ms 1 /classes/Product.php:6884
421 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 4464 AND `id_group` = 1 LIMIT 1
 0.089 ms 0 /classes/GroupReduction.php:153
474 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.089 ms 1 /classes/Product.php:5670
28 
SELECT SQL_NO_CACHE c.id_currency
FROM `prstshp_currency` c
WHERE (iso_code = 'USD') LIMIT 1
 0.088 ms 1 /classes/Currency.php:893
441 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 4462
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.088 ms 0 /classes/SpecificPrice.php:256
30 
SELECT SQL_NO_CACHE `id_lang` FROM `prstshp_lang`
WHERE `locale` = 'es-es'
OR `language_code` = 'es-es' LIMIT 1
 0.087 ms 2 /classes/Language.php:880
552 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 4420 AND id_shop=1 LIMIT 1
 0.087 ms 1 /classes/Product.php:6884
226 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 989
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.085 ms 0 /classes/SpecificPrice.php:256
238 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 990
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.085 ms 0 /classes/SpecificPrice.php:256
254 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 991 AND `id_group` = 1 LIMIT 1
 0.085 ms 0 /classes/GroupReduction.php:153
541 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 4421 AND `id_group` = 1 LIMIT 1
 0.085 ms 0 /classes/GroupReduction.php:153
38 
SELECT SQL_NO_CACHE ctg.`id_group`
FROM prstshp_category_group ctg
WHERE ctg.`id_category` = 2 AND ctg.`id_group` = 1 LIMIT 1
 0.084 ms 1 /classes/Category.php:1751
445 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 4462 AND `id_group` = 1 LIMIT 1
 0.084 ms 0 /classes/GroupReduction.php:153
27 
SELECT SQL_NO_CACHE `id_lang` FROM `prstshp_lang`
WHERE `locale` = 'es-es'
OR `language_code` = 'es-es' LIMIT 1
 0.084 ms 2 /classes/Language.php:880
36 
SELECT SQL_NO_CACHE id_shop
FROM `prstshp_group_shop`
WHERE `id_group` = 1
AND id_shop = 1 LIMIT 1
 0.083 ms 1 /classes/ObjectModel.php:1727
453 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 4459
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.083 ms 0 /classes/SpecificPrice.php:256
469 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 4457 AND `id_group` = 1 LIMIT 1
 0.082 ms 0 /classes/GroupReduction.php:153
616 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 4406
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.082 ms 0 /classes/SpecificPrice.php:256
33 
SELECT SQL_NO_CACHE id_shop
FROM `prstshp_currency_shop`
WHERE `id_currency` = 2
AND id_shop = 1 LIMIT 1
 0.081 ms 1 /classes/ObjectModel.php:1727
242 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 990 AND `id_group` = 1 LIMIT 1
 0.081 ms 0 /classes/GroupReduction.php:153
517 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 4423 AND `id_group` = 1 LIMIT 1
 0.078 ms 0 /classes/GroupReduction.php:153
529 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 4422 AND `id_group` = 1 LIMIT 1
 0.078 ms 0 /classes/GroupReduction.php:153
553 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 4420 AND `id_group` = 1 LIMIT 1
 0.073 ms 0 /classes/GroupReduction.php:153

Doubles

55 queries 
SELECT SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
54 queries 
SELECT
            COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), XX) as deep_quantity,
            COALESCE(SUM(first_level_quantity), XX) as quantity
          FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, XX as pack_quantity
          FROM `prstshp_cart_product` cp
            WHERE cp.`id_product_attribute` = XX
            
            AND cp.`id_cart` = XX AND cp.`id_product` = XX UNION SELECT XX as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
          FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
            WHERE cp.`id_product_attribute` = XX
            
            AND cp.`id_cart` = XX AND p.`id_product_item` = XX AND (pr.`pack_stock_type` IN (XX,XX) OR (
            pr.`pack_stock_type` = XX
            AND XX = XX
        ))) as q LIMIT XX
49 queries 
SELECT XX FROM `prstshp_specific_price` WHERE id_product = XX LIMIT XX
48 queries 
SELECT image_shop.`id_image`
                    FROM `prstshp_image` i
                     INNER JOIN prstshp_image_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
                    WHERE i.`id_product` = XX
                    AND image_shop.`cover` = XX LIMIT XX
48 queries 
SELECT name FROM prstshp_category_lang WHERE id_shop = XX AND id_lang = XX AND id_category = XX LIMIT XX
48 queries 
SELECT *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = XX
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = XX
WHERE (a.`id_product` = XX) AND (b.`id_shop` = XX) LIMIT XX
48 queries 
SELECT product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,XX) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = XX)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = XX)
WHERE (p.`id_product` = XX)
48 queries 
                            SELECT `id_tax_rules_group`
                            FROM `prstshp_product_shop`
                            WHERE `id_product` = XX AND id_shop=XX LIMIT XX
48 queries 
			SELECT `reduction`
			FROM `prstshp_product_group_reduction_cache`
			WHERE `id_product` = XX AND `id_group` = XX LIMIT XX
48 queries 
                SELECT name, value, pf.id_feature, f.position, fvl.id_feature_value
                FROM prstshp_feature_product pf
                LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = XX)
                LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = XX)
                LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = XX)
                 INNER JOIN prstshp_feature_shop feature_shop
        ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = XX)
                WHERE pf.id_product = XX
                ORDER BY f.position ASC
47 queries 
			SELECT *, ( IF (`id_group` = XX, XX, XX) +  IF (`id_country` = XX, XX, XX) +  IF (`id_currency` = XX, XX, XX) +  IF (`id_shop` = XX, XX, XX) +  IF (`id_customer` = XX, XX, XX)) AS `score`
				FROM `prstshp_specific_price`
				WHERE
                `id_shop` IN (XX, XX) AND
                `id_currency` IN (XX, XX) AND
                `id_country` IN (XX, XX) AND
                `id_group` IN (XX, XX) AND `id_product` = XX AND `id_customer` = XX AND `id_product_attribute` = XX AND `id_cart` = XX  AND (`from` = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' >= `from`) AND (`to` = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' <= `to`)
				AND IF(`from_quantity` > XX, `from_quantity`, XX) <= XX ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT XX
46 queries 
				SELECT `priority`, `id_specific_price_priority`
				FROM `prstshp_specific_price_priority`
				WHERE `id_product` = XX
				ORDER BY `id_specific_price_priority` DESC LIMIT XX
24 queries 
            SELECT image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
            FROM `prstshp_image` i
             INNER JOIN prstshp_image_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
            LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = XX)
            WHERE i.`id_product` = XX
            ORDER BY `position`
24 queries 
SELECT `id_product_attribute`
            FROM `prstshp_product_attribute`
            WHERE `id_product` = XX
24 queries 
SELECT pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > XX, XX, XX)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
            FROM `prstshp_product_attribute` pa
             INNER JOIN prstshp_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX) LEFT JOIN prstshp_stock_available stock
            ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, XX) AND stock.id_shop = XX  AND stock.id_shop_group = XX  )
            JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
            JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
            JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = XX)
            JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
            WHERE pa.`id_product` IN (XX) AND ag.`is_color_group` = XX
            GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
            HAVING qty > XX
            ORDER BY a.`position` ASC;
20 queries 
SELECT *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = XX
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = XX
WHERE (a.`id_category` = XX) AND (b.`id_shop` = XX) LIMIT XX
20 queries 
            SELECT pai.`id_image`, pai.`id_product_attribute`, il.`legend`
            FROM `prstshp_product_attribute_image` pai
            LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
            LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
            WHERE pai.`id_product_attribute` IN (XX) AND il.`id_lang` = XX ORDER by i.`position`
8 queries 
SELECT `id_module` FROM `prstshp_module_shop` WHERE `id_module` = XX AND `id_shop` = XX LIMIT XX
6 queries 
SELECT product_attribute_shop.`price`
			FROM `prstshp_product_attribute` pa
			 INNER JOIN prstshp_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX)
			WHERE pa.`id_product_attribute` = XX LIMIT XX
6 queries 
SELECT pa.`available_date` FROM `prstshp_product` p LEFT JOIN `prstshp_product_attribute` pa ON (pa.`id_product` = p.`id_product`) INNER JOIN prstshp_product_shop product_shop
        ON (product_shop.id_product = p.id_product AND product_shop.id_shop = XX) INNER JOIN prstshp_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX) WHERE p.`id_product` = XX AND pa.`id_product` = XX AND pa.`id_product_attribute` = XX LIMIT XX
6 queries 
            SELECT a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
            pa.`reference`, pa.`eanXX`, pa.`isbn`, pa.`upc`, pa.`mpn`,
            pal.`available_now`, pal.`available_later`
            FROM `prstshp_attribute` a
            LEFT JOIN `prstshp_attribute_lang` al
                ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = XX)
            LEFT JOIN `prstshp_product_attribute_combination` pac
                ON (pac.`id_attribute` = a.`id_attribute`)
            LEFT JOIN `prstshp_product_attribute` pa
                ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
             INNER JOIN prstshp_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX)
            LEFT JOIN `prstshp_product_attribute_lang` pal
                ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = XX)
            LEFT JOIN `prstshp_attribute_group_lang` agl
                ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = XX)
            WHERE pa.`id_product` = XX
                AND pac.`id_product_attribute` = XX
                AND agl.`id_lang` = XX
6 queries 
SELECT *
FROM `prstshp_product_attribute` a
LEFT JOIN `prstshp_product_attribute_shop` `c` ON a.`id_product_attribute` = c.`id_product_attribute` AND c.`id_shop` = XX
WHERE (a.`id_product_attribute` = XX) LIMIT XX
6 queries 
SELECT *
							FROM `prstshp_product_attribute_lang`
							WHERE `id_product_attribute` = XX
4 queries 
SELECT `id_lang` FROM `prstshp_lang`
                    WHERE `locale` = 'es-es'
                    OR `language_code` = 'es-es' LIMIT XX
4 queries 
SELECT *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = XX
WHERE (a.`id_product` = XX) LIMIT XX
4 queries 
SELECT *
							FROM `prstshp_product_lang`
							WHERE `id_product` = XX AND `id_shop` = XX
4 queries 
SELECT pa.*, product_attribute_shop.*
                FROM `prstshp_product_attribute` pa
                 INNER JOIN prstshp_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX)
                WHERE pa.`id_product` = XX
                GROUP BY pa.`id_product_attribute`
                ORDER BY pa.`id_product_attribute`
3 queries 
			SELECT cl.`link_rewrite`
			FROM `prstshp_category_lang` cl
			WHERE `id_lang` = XX
			 AND cl.id_shop = XX 
			AND cl.`id_category` = XX LIMIT XX
3 queries 
				SELECT tr.*
				FROM `prstshp_tax_rule` tr
				JOIN `prstshp_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
				WHERE trg.`active` = XX
				AND tr.`id_country` = XX
				AND tr.`id_tax_rules_group` = XX
				AND tr.`id_state` IN (XX, XX)
				AND ('XX' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
					OR (tr.`zipcode_to` = XX AND tr.`zipcode_from` IN(XX, 'XX')))
				ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
3 queries 
            SELECT pai.`id_image`, pai.`id_product_attribute`, il.`legend`
            FROM `prstshp_product_attribute_image` pai
            LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
            LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
            WHERE pai.`id_product_attribute` IN (XX, XX) AND il.`id_lang` = XX ORDER by i.`position`
3 queries 
SELECT pac.id_product_attribute, GROUP_CONCAT(agl.`name`, ' - ',al.`name` ORDER BY agl.`id_attribute_group` SEPARATOR ', ') as attribute_designation
                FROM `prstshp_product_attribute_combination` pac
                LEFT JOIN `prstshp_attribute` a ON a.`id_attribute` = pac.`id_attribute`
                LEFT JOIN `prstshp_attribute_group` ag ON ag.`id_attribute_group` = a.`id_attribute_group`
                LEFT JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = XX)
                LEFT JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = XX)
                WHERE pac.id_product_attribute IN (XX)
                GROUP BY pac.id_product_attribute
                ORDER BY pac.id_product_attribute
2 queries 
SELECT value FROM `prstshp_configuration` WHERE `name` = "PS_MULTISHOP_FEATURE_ACTIVE" LIMIT XX
2 queries 
SELECT *
FROM `prstshp_currency` a
LEFT JOIN `prstshp_currency_lang` `b` ON a.`id_currency` = b.`id_currency` AND b.`id_lang` = XX
LEFT JOIN `prstshp_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = XX
WHERE (a.`id_currency` = XX) LIMIT XX
2 queries 
		SELECT `id_category`
		FROM `prstshp_category_shop`
		WHERE `id_category` = XX
		AND `id_shop` = XX LIMIT XX
2 queries 
SELECT *
FROM `prstshp_category` aXX
LEFT JOIN `prstshp_category_lang` `aXX` ON (aXX.`id_category` = aXX.`id_category`)
WHERE (aXX.`nleft` < XX) AND (aXX.`nright` > XX) AND (aXX.`id_lang` = XX) AND (aXX.`id_shop` = XX)
ORDER BY aXX.`nleft` asc
2 queries 
SELECT XX FROM `prstshp_cart_rule` WHERE ((date_to >= "XX-XX-XX XX:XX:XX" AND date_to <= "XX-XX-XX XX:XX:XX") OR (date_from >= "XX-XX-XX XX:XX:XX" AND date_from <= "XX-XX-XX XX:XX:XX") OR (date_from < "XX-XX-XX XX:XX:XX" AND date_to > "XX-XX-XX XX:XX:XX")) AND `id_customer` IN (XX,XX) LIMIT XX

Tables stress

166 product
160 product_shop
110 cart_product
101 product_attribute_shop
100 specific_price
96 image
83 category_lang
83 stock_available
78 product_attribute
73 image_shop
54 product_lang
54 pack
49 image_lang
48 product_group_reduction_cache
48 feature_product
48 feature_lang
48 feature_value_lang
48 feature
48 feature_shop
46 specific_price_priority
36 product_attribute_combination
35 category
34 attribute
34 attribute_lang
28 attribute_group
24 category_shop
24 product_attribute_image
13 module
12 product_attribute_lang
10 module_shop
10 attribute_group_lang
7 lang
7 hook
7 currency
6 category_group
5 shop_url
5 configuration
5 currency_shop
5 category_product
4 shop
4 lang_shop
3 country
3 hook_alias
3 currency_lang
3 image_type
3 tax_rule
3 tax_rules_group
2 shop_group
2 configuration_lang
2 country_lang
2 country_shop
2 hook_module
2 group
2 group_shop
2 manufacturer
2 product_sale
2 cart_rule
2 psgdpr_consent
1 module_group
1 meta
1 meta_lang
1 hook_module_exceptions
1 group_lang
1 feature_flag
1 address_format
1 state
1 required_field
1 tax
1 tax_lang
1 layered_category
1 layered_filter_block
1 layered_price_index
1 iqit_elementor_category
1 corewhatsapp
1 psgdpr_consent_lang
1 connections
1 page_type
1 page

ObjectModel instances

Name Instances Source
Product 100 /classes/Link.php:113 (__construct) [id: 948]
/classes/Link.php:113 (__construct) [id: 959]
/classes/Link.php:113 (__construct) [id: 967]
/classes/Link.php:113 (__construct) [id: 969]
/classes/Link.php:113 (__construct) [id: 970]
/classes/Link.php:113 (__construct) [id: 971]
/classes/Link.php:113 (__construct) [id: 972]
/classes/Link.php:113 (__construct) [id: 975]
/classes/Link.php:113 (__construct) [id: 985]
/classes/Link.php:113 (__construct) [id: 986]
/classes/Link.php:113 (__construct) [id: 987]
/classes/Link.php:113 (__construct) [id: 989]
/classes/Link.php:113 (__construct) [id: 990]
/classes/Link.php:113 (__construct) [id: 991]
/classes/Link.php:113 (__construct) [id: 992]
/classes/Link.php:113 (__construct) [id: 993]
/classes/Link.php:113 (__construct) [id: 996]
/classes/Link.php:113 (__construct) [id: 997]
/classes/Link.php:113 (__construct) [id: 998]
/classes/Link.php:113 (__construct) [id: 999]
/classes/Link.php:113 (__construct) [id: 1009]
/classes/Link.php:113 (__construct) [id: 1012]
/classes/Link.php:113 (__construct) [id: 1013]
/classes/Link.php:113 (__construct) [id: 1014]
/classes/Link.php:113 (__construct) [id: 4464]
/classes/Link.php:113 (__construct) [id: 4463]
/classes/Link.php:113 (__construct) [id: 4462]
/classes/Link.php:113 (__construct) [id: 4459]
/classes/Link.php:113 (__construct) [id: 4457]
/classes/Link.php:113 (__construct) [id: 4452]
/classes/Link.php:113 (__construct) [id: 4435]
/classes/Link.php:113 (__construct) [id: 4430]
/classes/Link.php:113 (__construct) [id: 4423]
/classes/Link.php:113 (__construct) [id: 4422]
/classes/Link.php:113 (__construct) [id: 4421]
/classes/Link.php:113 (__construct) [id: 4420]
/classes/Link.php:113 (__construct) [id: 4419]
/classes/Link.php:113 (__construct) [id: 4418]
/classes/Link.php:113 (__construct) [id: 4417]
/classes/Link.php:113 (__construct) [id: 4414]
/classes/Link.php:113 (__construct) [id: 4406]
/classes/Link.php:113 (__construct) [id: 4404]
/classes/Link.php:113 (__construct) [id: 4403]
/classes/Link.php:113 (__construct) [id: 4400]
/classes/Link.php:113 (__construct) [id: 4399]
/classes/Link.php:113 (__construct) [id: 4398]
/classes/Link.php:113 (__construct) [id: 4397]
/classes/Link.php:113 (__construct) [id: 4390]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 4464]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 4463]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 4462]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 4459]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 4457]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 4452]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 4435]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 4430]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 4423]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 4422]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 4421]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 4420]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 4419]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 4418]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 4417]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 4414]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 4406]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 4404]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 4403]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 4400]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 4399]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 4398]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 4397]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 4390]
/classes/Link.php:113 (__construct) [id: 4464]
/classes/Link.php:113 (__construct) [id: 4463]
/classes/Link.php:113 (__construct) [id: 4462]
/classes/Link.php:113 (__construct) [id: 4459]
/classes/Link.php:113 (__construct) [id: 4457]
/classes/Link.php:113 (__construct) [id: 4452]
/classes/Link.php:113 (__construct) [id: 4435]
/classes/Link.php:113 (__construct) [id: 4430]
/classes/Link.php:113 (__construct) [id: 4423]
/classes/Link.php:113 (__construct) [id: 4422]
/classes/Link.php:113 (__construct) [id: 4421]
/classes/Link.php:113 (__construct) [id: 4420]
/classes/Link.php:113 (__construct) [id: 4419]
/classes/Link.php:113 (__construct) [id: 4418]
/classes/Link.php:113 (__construct) [id: 4417]
/classes/Link.php:113 (__construct) [id: 4414]
/classes/Link.php:113 (__construct) [id: 4406]
/classes/Link.php:113 (__construct) [id: 4404]
/classes/Link.php:113 (__construct) [id: 4403]
/classes/Link.php:113 (__construct) [id: 4400]
/classes/Link.php:113 (__construct) [id: 4399]
/classes/Link.php:113 (__construct) [id: 4398]
/classes/Link.php:113 (__construct) [id: 4397]
/classes/Link.php:113 (__construct) [id: 4390]
/src/Adapter/Presenter/Product/ProductLazyArray.php:658 (__construct) [id: 4414]
/src/Adapter/Presenter/Product/ProductLazyArray.php:658 (__construct) [id: 4399]
/src/Adapter/Presenter/Product/ProductLazyArray.php:658 (__construct) [id: 4398]
/src/Adapter/Presenter/Product/ProductLazyArray.php:658 (__construct) [id: 4397]
Category 25 /controllers/front/listing/CategoryController.php:76 (__construct) [id: 2]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 96]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 14]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 15]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 16]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 17]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 18]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 70]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 59]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 68]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 79]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 86]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 87]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 93]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 112]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 122]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 113]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 115]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 117]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 124]
/classes/Meta.php:379 (__construct) [id: 2]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/classes/Link.php:402 (__construct) [id: 2]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/modules/ps_facetedsearch/src/Filters/Block.php:157 (__construct) [id: 2]
Combination 6 /classes/Product.php:5923 (__construct) [id: 1791]
/classes/Product.php:5923 (__construct) [id: 1793]
/classes/Product.php:5923 (__construct) [id: 5236]
/classes/Product.php:5923 (__construct) [id: 5219]
/classes/Product.php:5923 (__construct) [id: 6947]
/classes/Product.php:5923 (__construct) [id: 5215]
Address 4 /classes/shop/Shop.php:486 (__construct) [id: ]
/classes/Product.php:3694 (initialize) [id: ]
/classes/Product.php:3804 (__construct) [id: ]
/classes/Product.php:5975 (__construct) [id: ]
Country 4 /config/config.inc.php:146 (__construct) [id: 6]
/classes/controller/FrontController.php:354 (__construct) [id: 6]
/classes/AddressFormat.php:404 (__construct) [id: 6]
/classes/controller/FrontController.php:1769 (__construct) [id: 6]
Currency 3 /src/Adapter/Currency/CurrencyDataProvider.php:101 (__construct) [id: 2]
/src/Adapter/Currency/CurrencyDataProvider.php:101 (__construct) [id: 1]
/classes/Tools.php:696 (getCurrencyInstance) [id: 2]
State 2 /classes/AddressFormat.php:404 (__construct) [id: 362]
/classes/controller/FrontController.php:1768 (__construct) [id: 362]
Language 2 /config/config.inc.php:211 (__construct) [id: 2]
/classes/Tools.php:561 (__construct) [id: 2]
Cart 2 /classes/controller/FrontController.php:467 (__construct) [id: ]
/classes/controller/FrontController.php:541 (__construct) [id: ]
Tax 2 /classes/tax/TaxRulesTaxManager.php:116 (__construct) [id: 53]
/classes/tax/TaxRulesTaxManager.php:116 (__construct) [id: 53]
Connection 1 /modules/statsdata/statsdata.php:118 (setPageConnection) [id: ]
Guest 1 /modules/statsdata/statsdata.php:82 (setNewGuest) [id: ]
IqitElementorCategory 1 /modules/iqitelementor/iqitelementor.php:784 (isJustElementor) [id: ]
Shop 1 /config/config.inc.php:117 (initialize) [id: 1]
Configuration 1 /modules/ps_accounts/src/Adapter/Configuration.php:239 (__construct) [id: 1315]
AddressFormat 1 /classes/controller/FrontController.php:1763 (generateAddress) [id: ]
Risk 1 /classes/controller/FrontController.php:1695 (__construct) [id: ]
Gender 1 /classes/controller/FrontController.php:1692 (__construct) [id: 0]
Group 1 /classes/Cart.php:249 (getCurrent) [id: 1]
Customer 1 /config/config.inc.php:264 (__construct) [id: ]
ShopGroup 1 /classes/shop/Shop.php:561 (__construct) [id: 1]
ConnectionsSource 1 /modules/statsdata/statsdata.php:119 (logHttpReferer) [id: ]

Included Files

# Filename
0 /index.php
1 /config/config.inc.php
2 /config/defines.inc.php
3 /config/autoload.php
4 /vendor/autoload.php
5 /vendor/composer/autoload_real.php
6 /vendor/composer/platform_check.php
7 /vendor/composer/ClassLoader.php
8 /vendor/composer/include_paths.php
9 /vendor/composer/autoload_static.php
10 /vendor/symfony/polyfill-php72/bootstrap.php
11 /vendor/symfony/polyfill-mbstring/bootstrap.php
12 /vendor/symfony/polyfill-mbstring/bootstrap80.php
13 /vendor/symfony/polyfill-intl-normalizer/bootstrap.php
14 /vendor/symfony/polyfill-intl-normalizer/bootstrap80.php
15 /vendor/symfony/polyfill-intl-idn/bootstrap.php
16 /vendor/symfony/deprecation-contracts/function.php
17 /vendor/ralouphie/getallheaders/src/getallheaders.php
18 /vendor/symfony/polyfill-ctype/bootstrap.php
19 /vendor/symfony/polyfill-ctype/bootstrap80.php
20 /vendor/symfony/polyfill-php80/bootstrap.php
21 /vendor/guzzlehttp/promises/src/functions_include.php
22 /vendor/guzzlehttp/promises/src/functions.php
23 /vendor/guzzlehttp/guzzle/src/functions_include.php
24 /vendor/guzzlehttp/guzzle/src/functions.php
25 /vendor/symfony/polyfill-iconv/bootstrap.php
26 /vendor/ezyang/htmlpurifier/library/HTMLPurifier.composer.php
27 /vendor/jakeasmith/http_build_url/src/http_build_url.php
28 /vendor/lcobucci/jwt/compat/class-aliases.php
29 /vendor/lcobucci/jwt/src/Token.php
30 /vendor/lcobucci/jwt/src/Signature.php
31 /vendor/lcobucci/jwt/compat/json-exception-polyfill.php
32 /vendor/lcobucci/jwt/compat/lcobucci-clock-polyfill.php
33 /vendor/swiftmailer/swiftmailer/lib/swift_required.php
34 /vendor/swiftmailer/swiftmailer/lib/classes/Swift.php
35 /vendor/symfony/polyfill-intl-icu/bootstrap.php
36 /vendor/symfony/polyfill-php73/bootstrap.php
37 /vendor/symfony/polyfill-php81/bootstrap.php
38 /vendor/api-platform/core/src/deprecation.php
39 /vendor/api-platform/core/src/Api/FilterInterface.php
40 /vendor/api-platform/core/src/Api/ResourceClassResolverInterface.php
41 /vendor/api-platform/core/src/deprecated_interfaces.php
42 /vendor/api-platform/core/src/Metadata/Property/Factory/PropertyNameCollectionFactoryInterface.php
43 /vendor/api-platform/core/src/Metadata/Resource/Factory/ResourceNameCollectionFactoryInterface.php
44 /vendor/api-platform/core/src/Metadata/Extractor/ResourceExtractorInterface.php
45 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/DateFilterInterface.php
46 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/ExistsFilterInterface.php
47 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/OrderFilterInterface.php
48 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/RangeFilterInterface.php
49 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/SearchFilterInterface.php
50 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationCollectionExtensionInterface.php
51 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationItemExtensionInterface.php
52 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultCollectionExtensionInterface.php
53 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultItemExtensionInterface.php
54 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Filter/FilterInterface.php
55 /vendor/api-platform/core/src/Doctrine/Orm/QueryAwareInterface.php
56 /vendor/api-platform/core/src/Doctrine/Orm/Util/QueryNameGeneratorInterface.php
57 /vendor/api-platform/core/src/Elasticsearch/Metadata/Document/Factory/DocumentMetadataFactoryInterface.php
58 /vendor/api-platform/core/src/Symfony/Validator/ValidationGroupsGeneratorInterface.php
59 /vendor/api-platform/core/src/Symfony/Validator/Exception/ConstraintViolationListAwareExceptionInterface.php
60 /vendor/api-platform/core/src/Exception/ExceptionInterface.php
61 /vendor/api-platform/core/src/Core/Bridge/Symfony/Validator/Metadata/Property/Restriction/PropertySchemaRestrictionMetadataInterface.php
62 /vendor/api-platform/core/src/State/Pagination/PaginatorInterface.php
63 /vendor/api-platform/core/src/State/Pagination/PartialPaginatorInterface.php
64 /vendor/api-platform/core/src/Documentation/DocumentationInterface.php
65 /vendor/api-platform/core/src/JsonLd/AnonymousContextBuilderInterface.php
66 /vendor/api-platform/core/src/JsonLd/ContextBuilderInterface.php
67 /vendor/api-platform/core/src/Core/JsonSchema/SchemaFactoryInterface.php
68 /vendor/api-platform/core/src/JsonSchema/TypeFactoryInterface.php
69 /vendor/api-platform/core/src/OpenApi/Factory/OpenApiFactoryInterface.php
70 /vendor/api-platform/core/src/PathResolver/OperationPathResolverInterface.php
71 /vendor/api-platform/core/src/Symfony/Security/ResourceAccessCheckerInterface.php
72 /vendor/api-platform/core/src/Serializer/Filter/FilterInterface.php
73 /vendor/api-platform/core/src/Serializer/SerializerContextBuilderInterface.php
74 /vendor/api-platform/core/src/Validator/ValidatorInterface.php
75 /vendor/api-platform/core/src/Api/UrlGeneratorInterface.php
76 /vendor/api-platform/core/src/GraphQl/ExecutorInterface.php
77 /vendor/api-platform/core/src/GraphQl/Error/ErrorHandlerInterface.php
78 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ValidateStageInterface.php
79 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ReadStageInterface.php
80 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityPostDenormalizeStageInterface.php
81 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityStageInterface.php
82 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/WriteStageInterface.php
83 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SerializeStageInterface.php
84 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/DeserializeStageInterface.php
85 /vendor/api-platform/core/src/GraphQl/Resolver/QueryItemResolverInterface.php
86 /vendor/api-platform/core/src/GraphQl/Resolver/QueryCollectionResolverInterface.php
87 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Factory/ResolverFactoryInterface.php
88 /vendor/api-platform/core/src/GraphQl/Resolver/MutationResolverInterface.php
89 /vendor/api-platform/core/src/Core/GraphQl/Subscription/MercureSubscriptionIriGeneratorInterface.php
90 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionIdentifierGeneratorInterface.php
91 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionManagerInterface.php
92 /vendor/api-platform/core/src/Core/GraphQl/Serializer/SerializerContextBuilderInterface.php
93 /vendor/api-platform/core/src/GraphQl/Type/TypesFactoryInterface.php
94 /vendor/api-platform/core/src/GraphQl/Type/Definition/TypeInterface.php
95 /vendor/api-platform/core/src/GraphQl/Type/TypesContainerInterface.php
96 /vendor/psr/container/src/ContainerInterface.php
97 /vendor/api-platform/core/src/Operation/PathSegmentNameGeneratorInterface.php
98 /vendor/ircmaxell/password-compat/lib/password.php
99 /vendor/martinlindhe/php-mb-helpers/src/mb_helpers.php
100 /vendor/prestashop/laminas-code-lts/polyfill/ReflectionEnumPolyfill.php
101 /src/Core/Version.php
102 /config/alias.php
103 /vendor/prestashop/autoload/src/PrestashopAutoload.php
104 /vendor/prestashop/autoload/src/LegacyClassLoader.php
105 /vendor/symfony/symfony/src/Symfony/Component/Filesystem/Filesystem.php
106 /vendor/prestashop/autoload/src/Autoloader.php
107 /config/bootstrap.php
108 /src/Core/ContainerBuilder.php
109 /src/Core/Foundation/IoC/Container.php
110 /src/Adapter/ServiceLocator.php
111 /var/cache/prod/appParameters.php
114 /var/cache/prod/class_index.php
115 /classes/controller/Controller.php
117 /classes/ObjectModel.php
118 /src/Core/Foundation/Database/EntityInterface.php
120 /classes/db/Db.php
122 /classes/Hook.php
124 /classes/module/Module.php
125 /src/Core/Module/Legacy/ModuleInterface.php
127 /classes/Tools.php
128 /classes/Context.php
129 /classes/shop/Shop.php
130 /src/Core/Security/PasswordGenerator.php
131 /classes/db/DbPDO.php
132 /classes/AddressFormat.php
133 /classes/Configuration.php
134 /classes/Validate.php
135 /classes/cache/Cache.php
136 /src/Adapter/EntityMapper.php
137 /classes/db/DbQuery.php
138 /src/Core/Addon/Theme/ThemeManagerBuilder.php
139 /vendor/psr/log/Psr/Log/NullLogger.php
140 /vendor/psr/log/Psr/Log/AbstractLogger.php
141 /vendor/psr/log/Psr/Log/LoggerInterface.php
142 /src/Adapter/Configuration.php
143 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ParameterBag.php
144 /src/Core/Domain/Configuration/ShopConfigurationInterface.php
145 /src/Core/ConfigurationInterface.php
146 /src/Core/Addon/Theme/ThemeRepository.php
147 /src/Core/Addon/AddonRepositoryInterface.php
148 /src/Core/Domain/Shop/ValueObject/ShopConstraint.php
149 /src/Core/Addon/Theme/Theme.php
150 /src/Core/Addon/AddonInterface.php
151 /src/Core/Util/ArrayFinder.php
152 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccess.php
153 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorBuilder.php
154 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessor.php
155 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorInterface.php
156 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPath.php
157 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPathInterface.php
158 /config/defines_uri.inc.php
159 /classes/Language.php
160 /src/Core/Language/LanguageInterface.php
161 /classes/Country.php
162 /classes/PrestaShopCollection.php
163 /classes/shop/ShopGroup.php
164 /classes/Cookie.php
165 /classes/PhpEncryption.php
166 /classes/PhpEncryptionEngine.php
167 /vendor/defuse/php-encryption/src/Key.php
168 /vendor/defuse/php-encryption/src/Encoding.php
169 /vendor/defuse/php-encryption/src/Core.php
170 /src/Core/Session/SessionHandler.php
171 /src/Core/Session/SessionHandlerInterface.php
172 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Session.php
173 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBag.php
174 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBagInterface.php
175 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagInterface.php
176 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBag.php
177 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBagInterface.php
178 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagProxy.php
179 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionInterface.php
180 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/PhpBridgeSessionStorage.php
181 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/NativeSessionStorage.php
182 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/MetadataBag.php
183 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/StrictSessionHandler.php
184 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/AbstractSessionHandler.php
185 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/SessionHandlerProxy.php
186 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/AbstractProxy.php
187 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/SessionStorageInterface.php
188 /config/smarty.config.inc.php
189 /vendor/smarty/smarty/libs/Smarty.class.php
190 /vendor/smarty/smarty/libs/functions.php
191 /vendor/smarty/smarty/libs/Autoloader.php
192 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_data.php
193 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_extension_handler.php
194 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php
195 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php
196 /vendor/smarty/smarty/libs/sysplugins/smarty_resource.php
197 /vendor/smarty/smarty/libs/sysplugins/smarty_variable.php
198 /vendor/smarty/smarty/libs/sysplugins/smarty_template_source.php
199 /vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php
200 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_resource_file.php
201 /config/smartyfront.config.inc.php
202 /classes/Smarty/SmartyResourceModule.php
203 /vendor/smarty/smarty/libs/sysplugins/smarty_resource_custom.php
204 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerresource.php
205 /classes/Smarty/SmartyResourceParent.php
206 /classes/Smarty/SmartyLazyRegister.php
207 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerplugin.php
208 /vendor/smarty/smarty/libs/plugins/modifier.truncate.php
209 /classes/Customer.php
210 /classes/Group.php
211 /classes/Link.php
212 /classes/shop/ShopUrl.php
213 /classes/Dispatcher.php
214 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Request.php
215 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeader.php
216 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeaderItem.php
217 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/FileBag.php
218 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderBag.php
219 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderUtils.php
220 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ServerBag.php
221 /src/Adapter/SymfonyContainer.php
222 /vendor/mobiledetect/mobiledetectlib/Mobile_Detect.php
223 /config/db_slave_server.inc.php
224 /src/Adapter/ContainerBuilder.php
225 /src/Adapter/Environment.php
226 /src/Core/EnvironmentInterface.php
227 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCache.php
228 /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerConfigCache.php
229 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheInterface.php
230 /vendor/symfony/symfony/src/Symfony/Component/Cache/DoctrineProvider.php
231 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/CacheProvider.php
232 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Cache.php
233 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/FlushableCache.php
234 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/ClearableCache.php
235 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiOperationCache.php
236 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiGetCache.php
237 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiDeleteCache.php
238 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiPutCache.php
239 /vendor/symfony/symfony/src/Symfony/Component/Cache/PruneableInterface.php
240 /vendor/symfony/symfony/src/Symfony/Component/Cache/ResettableInterface.php
241 /vendor/symfony/contracts/Service/ResetInterface.php
242 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/ArrayAdapter.php
243 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ArrayTrait.php
244 /vendor/psr/log/Psr/Log/LoggerAwareTrait.php
245 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AdapterInterface.php
246 /vendor/symfony/symfony/src/Symfony/Component/Cache/CacheItem.php
247 /vendor/symfony/contracts/Cache/ItemInterface.php
248 /vendor/psr/cache/src/CacheItemInterface.php
249 /vendor/psr/cache/src/CacheItemPoolInterface.php
250 /vendor/symfony/contracts/Cache/CacheInterface.php
251 /vendor/psr/log/Psr/Log/LoggerAwareInterface.php
252 /vendor/doctrine/orm/lib/Doctrine/ORM/Tools/Setup.php
253 /vendor/doctrine/deprecations/lib/Doctrine/Deprecations/Deprecation.php
254 /vendor/doctrine/orm/lib/Doctrine/ORM/Configuration.php
255 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Configuration.php
256 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/CacheAdapter.php
257 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/DoctrineProvider.php
258 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationReader.php
259 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Reader.php
260 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationRegistry.php
261 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/DoctrineAnnotations.php
262 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Annotation.php
263 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Entity.php
264 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embeddable.php
265 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embedded.php
266 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/MappedSuperclass.php
267 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/InheritanceType.php
268 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorColumn.php
269 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorMap.php
270 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Id.php
271 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/GeneratedValue.php
272 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Version.php
273 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumn.php
274 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumns.php
275 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Column.php
276 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToOne.php
277 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToMany.php
278 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToOne.php
279 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToMany.php
280 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Table.php
281 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/UniqueConstraint.php
282 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Index.php
283 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinTable.php
284 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SequenceGenerator.php
285 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/CustomIdGenerator.php
286 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ChangeTrackingPolicy.php
287 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OrderBy.php
288 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQueries.php
289 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQuery.php
290 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/HasLifecycleCallbacks.php
291 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PrePersist.php
292 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostPersist.php
293 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreUpdate.php
294 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostUpdate.php
295 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreRemove.php
296 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostRemove.php
297 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostLoad.php
298 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreFlush.php
299 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/FieldResult.php
300 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ColumnResult.php
301 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityResult.php
302 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQuery.php
303 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQueries.php
304 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMapping.php
305 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMappings.php
306 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverride.php
307 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverrides.php
308 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverride.php
309 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverrides.php
310 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityListeners.php
311 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Cache.php
312 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/SimpleAnnotationReader.php
313 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocParser.php
314 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocLexer.php
315 /vendor/doctrine/lexer/lib/Doctrine/Common/Lexer/AbstractLexer.php
316 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Target.php
317 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/AnnotationDriver.php
318 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/CompatibilityAnnotationDriver.php
319 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/MappingDriver.php
320 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/ColocatedMappingDriver.php
321 /var/cache/prod/FrontContainer.php
322 /src/Adapter/Container/LegacyContainer.php
323 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Container.php
324 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/RewindableGenerator.php
325 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/ServiceLocator.php
326 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ServiceLocator.php
327 /vendor/symfony/contracts/Service/ServiceLocatorTrait.php
328 /vendor/psr/container/src/ContainerExceptionInterface.php
329 /vendor/psr/container/src/NotFoundExceptionInterface.php
330 /vendor/symfony/contracts/Service/ServiceProviderInterface.php
331 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ResettableContainerInterface.php
332 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ContainerInterface.php
333 /src/Adapter/Container/LegacyContainerInterface.php
334 /modules/blockwishlist/vendor/autoload.php
335 /modules/blockwishlist/vendor/composer/autoload_real.php
336 /modules/blockwishlist/vendor/composer/autoload_static.php
337 /modules/contactform/vendor/autoload.php
338 /modules/contactform/vendor/composer/autoload_real.php
339 /modules/contactform/vendor/composer/autoload_static.php
340 /modules/dashactivity/vendor/autoload.php
341 /modules/dashactivity/vendor/composer/autoload_real.php
342 /modules/dashactivity/vendor/composer/autoload_static.php
343 /modules/dashtrends/vendor/autoload.php
344 /modules/dashtrends/vendor/composer/autoload_real.php
345 /modules/dashtrends/vendor/composer/autoload_static.php
346 /modules/dashgoals/vendor/autoload.php
347 /modules/dashgoals/vendor/composer/autoload_real.php
348 /modules/dashgoals/vendor/composer/autoload_static.php
349 /modules/dashproducts/vendor/autoload.php
350 /modules/dashproducts/vendor/composer/autoload_real.php
351 /modules/dashproducts/vendor/composer/platform_check.php
352 /modules/dashproducts/vendor/composer/autoload_static.php
353 /modules/graphnvd3/vendor/autoload.php
354 /modules/graphnvd3/vendor/composer/autoload_real.php
355 /modules/graphnvd3/vendor/composer/autoload_static.php
356 /modules/gridhtml/vendor/autoload.php
357 /modules/gridhtml/vendor/composer/autoload_real.php
358 /modules/gridhtml/vendor/composer/autoload_static.php
359 /modules/gsitemap/vendor/autoload.php
360 /modules/gsitemap/vendor/composer/autoload_real.php
361 /modules/gsitemap/vendor/composer/platform_check.php
362 /modules/gsitemap/vendor/composer/autoload_static.php
363 /modules/pagesnotfound/vendor/autoload.php
364 /modules/pagesnotfound/vendor/composer/autoload_real.php
365 /modules/pagesnotfound/vendor/composer/platform_check.php
366 /modules/pagesnotfound/vendor/composer/autoload_static.php
367 /modules/productcomments/vendor/autoload.php
368 /modules/productcomments/vendor/composer/autoload_real.php
369 /modules/productcomments/vendor/composer/platform_check.php
370 /modules/productcomments/vendor/composer/autoload_static.php
371 /modules/ps_checkpayment/vendor/autoload.php
372 /modules/ps_checkpayment/vendor/composer/autoload_real.php
373 /modules/ps_checkpayment/vendor/composer/autoload_static.php
374 /modules/ps_contactinfo/vendor/autoload.php
375 /modules/ps_contactinfo/vendor/composer/autoload_real.php
376 /modules/ps_contactinfo/vendor/composer/autoload_static.php
377 /modules/ps_crossselling/vendor/autoload.php
378 /modules/ps_crossselling/vendor/composer/autoload_real.php
379 /modules/ps_crossselling/vendor/composer/platform_check.php
380 /modules/ps_crossselling/vendor/composer/autoload_static.php
381 /modules/ps_currencyselector/vendor/autoload.php
382 /modules/ps_currencyselector/vendor/composer/autoload_real.php
383 /modules/ps_currencyselector/vendor/composer/autoload_static.php
384 /modules/ps_customeraccountlinks/vendor/autoload.php
385 /modules/ps_customeraccountlinks/vendor/composer/autoload_real.php
386 /modules/ps_customeraccountlinks/vendor/composer/autoload_static.php
387 /modules/ps_customtext/vendor/autoload.php
388 /modules/ps_customtext/vendor/composer/autoload_real.php
389 /modules/ps_customtext/vendor/composer/platform_check.php
390 /modules/ps_customtext/vendor/composer/autoload_static.php
391 /modules/ps_dataprivacy/vendor/autoload.php
392 /modules/ps_dataprivacy/vendor/composer/autoload_real.php
393 /modules/ps_dataprivacy/vendor/composer/autoload_static.php
394 /modules/ps_emailsubscription/vendor/autoload.php
395 /modules/ps_emailsubscription/vendor/composer/autoload_real.php
396 /modules/ps_emailsubscription/vendor/composer/platform_check.php
397 /modules/ps_emailsubscription/vendor/composer/autoload_static.php
398 /modules/ps_faviconnotificationbo/vendor/autoload.php
399 /modules/ps_faviconnotificationbo/vendor/composer/autoload_real.php
400 /modules/ps_faviconnotificationbo/vendor/composer/platform_check.php
401 /modules/ps_faviconnotificationbo/vendor/composer/autoload_static.php
402 /modules/ps_featuredproducts/vendor/autoload.php
403 /modules/ps_featuredproducts/vendor/composer/autoload_real.php
404 /modules/ps_featuredproducts/vendor/composer/platform_check.php
405 /modules/ps_featuredproducts/vendor/composer/autoload_static.php
406 /modules/ps_imageslider/vendor/autoload.php
407 /modules/ps_imageslider/vendor/composer/autoload_real.php
408 /modules/ps_imageslider/vendor/composer/platform_check.php
409 /modules/ps_imageslider/vendor/composer/autoload_static.php
410 /modules/ps_languageselector/vendor/autoload.php
411 /modules/ps_languageselector/vendor/composer/autoload_real.php
412 /modules/ps_languageselector/vendor/composer/autoload_static.php
413 /modules/ps_linklist/vendor/autoload.php
414 /modules/ps_linklist/vendor/composer/autoload_real.php
415 /modules/ps_linklist/vendor/composer/autoload_static.php
416 /modules/ps_mainmenu/vendor/autoload.php
417 /modules/ps_mainmenu/vendor/composer/autoload_real.php
418 /modules/ps_mainmenu/vendor/composer/platform_check.php
419 /modules/ps_mainmenu/vendor/composer/autoload_static.php
420 /modules/ps_searchbar/vendor/autoload.php
421 /modules/ps_searchbar/vendor/composer/autoload_real.php
422 /modules/ps_searchbar/vendor/composer/autoload_static.php
423 /modules/ps_sharebuttons/vendor/autoload.php
424 /modules/ps_sharebuttons/vendor/composer/autoload_real.php
425 /modules/ps_sharebuttons/vendor/composer/autoload_static.php
426 /modules/ps_shoppingcart/vendor/autoload.php
427 /modules/ps_shoppingcart/vendor/composer/autoload_real.php
428 /modules/ps_shoppingcart/vendor/composer/autoload_static.php
429 /modules/ps_socialfollow/vendor/autoload.php
430 /modules/ps_socialfollow/vendor/composer/autoload_real.php
431 /modules/ps_socialfollow/vendor/composer/platform_check.php
432 /modules/ps_socialfollow/vendor/composer/autoload_static.php
433 /modules/ps_themecusto/vendor/autoload.php
434 /modules/ps_themecusto/vendor/composer/autoload_real.php
435 /modules/ps_themecusto/vendor/composer/autoload_static.php
436 /modules/ps_wirepayment/vendor/autoload.php
437 /modules/ps_wirepayment/vendor/composer/autoload_real.php
438 /modules/ps_wirepayment/vendor/composer/platform_check.php
439 /modules/ps_wirepayment/vendor/composer/autoload_static.php
440 /modules/statsbestcategories/vendor/autoload.php
441 /modules/statsbestcategories/vendor/composer/autoload_real.php
442 /modules/statsbestcategories/vendor/composer/platform_check.php
443 /modules/statsbestcategories/vendor/composer/autoload_static.php
444 /modules/statsbestcustomers/vendor/autoload.php
445 /modules/statsbestcustomers/vendor/composer/autoload_real.php
446 /modules/statsbestcustomers/vendor/composer/platform_check.php
447 /modules/statsbestcustomers/vendor/composer/autoload_static.php
448 /modules/statsbestproducts/vendor/autoload.php
449 /modules/statsbestproducts/vendor/composer/autoload_real.php
450 /modules/statsbestproducts/vendor/composer/platform_check.php
451 /modules/statsbestproducts/vendor/composer/autoload_static.php
452 /modules/statsbestsuppliers/vendor/autoload.php
453 /modules/statsbestsuppliers/vendor/composer/autoload_real.php
454 /modules/statsbestsuppliers/vendor/composer/platform_check.php
455 /modules/statsbestsuppliers/vendor/composer/autoload_static.php
456 /modules/statsbestvouchers/vendor/autoload.php
457 /modules/statsbestvouchers/vendor/composer/autoload_real.php
458 /modules/statsbestvouchers/vendor/composer/platform_check.php
459 /modules/statsbestvouchers/vendor/composer/autoload_static.php
460 /modules/statscarrier/vendor/autoload.php
461 /modules/statscarrier/vendor/composer/autoload_real.php
462 /modules/statscarrier/vendor/composer/platform_check.php
463 /modules/statscarrier/vendor/composer/autoload_static.php
464 /modules/statscatalog/vendor/autoload.php
465 /modules/statscatalog/vendor/composer/autoload_real.php
466 /modules/statscatalog/vendor/composer/platform_check.php
467 /modules/statscatalog/vendor/composer/autoload_static.php
468 /modules/statscheckup/vendor/autoload.php
469 /modules/statscheckup/vendor/composer/autoload_real.php
470 /modules/statscheckup/vendor/composer/platform_check.php
471 /modules/statscheckup/vendor/composer/autoload_static.php
472 /modules/statsdata/vendor/autoload.php
473 /modules/statsdata/vendor/composer/autoload_real.php
474 /modules/statsdata/vendor/composer/platform_check.php
475 /modules/statsdata/vendor/composer/autoload_static.php
476 /modules/statsforecast/vendor/autoload.php
477 /modules/statsforecast/vendor/composer/autoload_real.php
478 /modules/statsforecast/vendor/composer/platform_check.php
479 /modules/statsforecast/vendor/composer/autoload_static.php
480 /modules/statsnewsletter/vendor/autoload.php
481 /modules/statsnewsletter/vendor/composer/autoload_real.php
482 /modules/statsnewsletter/vendor/composer/platform_check.php
483 /modules/statsnewsletter/vendor/composer/autoload_static.php
484 /modules/statspersonalinfos/vendor/autoload.php
485 /modules/statspersonalinfos/vendor/composer/autoload_real.php
486 /modules/statspersonalinfos/vendor/composer/platform_check.php
487 /modules/statspersonalinfos/vendor/composer/autoload_static.php
488 /modules/statsproduct/vendor/autoload.php
489 /modules/statsproduct/vendor/composer/autoload_real.php
490 /modules/statsproduct/vendor/composer/platform_check.php
491 /modules/statsproduct/vendor/composer/autoload_static.php
492 /modules/statsregistrations/vendor/autoload.php
493 /modules/statsregistrations/vendor/composer/autoload_real.php
494 /modules/statsregistrations/vendor/composer/platform_check.php
495 /modules/statsregistrations/vendor/composer/autoload_static.php
496 /modules/statssales/vendor/autoload.php
497 /modules/statssales/vendor/composer/autoload_real.php
498 /modules/statssales/vendor/composer/platform_check.php
499 /modules/statssales/vendor/composer/autoload_static.php
500 /modules/statssearch/vendor/autoload.php
501 /modules/statssearch/vendor/composer/autoload_real.php
502 /modules/statssearch/vendor/composer/platform_check.php
503 /modules/statssearch/vendor/composer/autoload_static.php
504 /modules/statsstock/vendor/autoload.php
505 /modules/statsstock/vendor/composer/autoload_real.php
506 /modules/statsstock/vendor/composer/platform_check.php
507 /modules/statsstock/vendor/composer/autoload_static.php
508 /modules/psgdpr/vendor/autoload.php
509 /modules/psgdpr/vendor/composer/autoload_real.php
510 /modules/psgdpr/vendor/composer/autoload_static.php
511 /modules/ps_metrics/vendor/autoload.php
512 /modules/ps_metrics/vendor/composer/autoload_real.php
513 /modules/ps_metrics/vendor/composer/autoload_static.php
514 /modules/ps_metrics/vendor/symfony/polyfill-php80/bootstrap.php
515 /modules/ps_metrics/vendor/symfony/deprecation-contracts/function.php
516 /modules/ps_metrics/vendor/symfony/polyfill-mbstring/bootstrap.php
517 /modules/ps_metrics/vendor/symfony/polyfill-mbstring/bootstrap80.php
518 /modules/ps_metrics/vendor/symfony/polyfill-ctype/bootstrap.php
519 /modules/ps_metrics/vendor/symfony/polyfill-ctype/bootstrap80.php
520 /modules/ps_metrics/vendor/symfony/polyfill-php73/bootstrap.php
521 /modules/ps_metrics/vendor/symfony/polyfill-intl-grapheme/bootstrap.php
522 /modules/ps_metrics/vendor/symfony/polyfill-intl-normalizer/bootstrap.php
523 /modules/ps_metrics/vendor/symfony/polyfill-intl-normalizer/bootstrap80.php
524 /modules/ps_metrics/vendor/symfony/string/Resources/functions.php
525 /modules/ps_metrics/vendor/clue/stream-filter/src/functions_include.php
526 /modules/ps_metrics/vendor/clue/stream-filter/src/functions.php
527 /modules/ps_metrics/vendor/ralouphie/getallheaders/src/getallheaders.php
528 /modules/ps_metrics/vendor/guzzlehttp/psr7/src/functions_include.php
529 /modules/ps_metrics/vendor/guzzlehttp/psr7/src/functions.php
530 /modules/ps_metrics/vendor/php-http/message/src/filters.php
531 /modules/ps_metrics/vendor/symfony/polyfill-php81/bootstrap.php
532 /modules/ps_metrics/vendor/phpstan/phpstan/bootstrap.php
533 /modules/ps_metrics/vendor/segmentio/analytics-php/lib/Segment.php
534 /modules/ps_metrics/vendor/segmentio/analytics-php/lib/Segment/Client.php
535 /modules/ps_metrics/vendor/segmentio/analytics-php/lib/Segment/Consumer.php
536 /modules/ps_metrics/vendor/segmentio/analytics-php/lib/Segment/QueueConsumer.php
537 /modules/ps_metrics/vendor/segmentio/analytics-php/lib/Segment/Consumer/File.php
538 /modules/ps_metrics/vendor/segmentio/analytics-php/lib/Segment/Consumer/ForkCurl.php
539 /modules/ps_metrics/vendor/segmentio/analytics-php/lib/Segment/Consumer/Socket.php
540 /modules/ps_facebook/vendor/autoload.php
541 /modules/ps_facebook/vendor/composer/autoload_real.php
542 /modules/ps_facebook/vendor/composer/autoload_static.php
543 /modules/ps_facebook/vendor/segmentio/analytics-php/lib/Segment.php
544 /modules/ps_facebook/vendor/segmentio/analytics-php/lib/Segment/Client.php
545 /modules/ps_facebook/vendor/segmentio/analytics-php/lib/Segment/Consumer.php
546 /modules/ps_facebook/vendor/segmentio/analytics-php/lib/Segment/QueueConsumer.php
547 /modules/ps_facebook/vendor/segmentio/analytics-php/lib/Segment/Consumer/File.php
548 /modules/ps_facebook/vendor/segmentio/analytics-php/lib/Segment/Consumer/ForkCurl.php
549 /modules/ps_facebook/vendor/segmentio/analytics-php/lib/Segment/Consumer/LibCurl.php
550 /modules/ps_facebook/vendor/segmentio/analytics-php/lib/Segment/Consumer/Socket.php
551 /modules/ps_facebook/vendor/segmentio/analytics-php/lib/Segment/Version.php
552 /modules/psxmarketingwithgoogle/vendor/autoload.php
553 /modules/psxmarketingwithgoogle/vendor/composer/autoload_real.php
554 /modules/psxmarketingwithgoogle/vendor/composer/autoload_static.php
555 /modules/blockreassurance/vendor/autoload.php
556 /modules/blockreassurance/vendor/composer/autoload_real.php
557 /modules/blockreassurance/vendor/composer/autoload_static.php
558 /modules/ps_facetedsearch/vendor/autoload.php
559 /modules/ps_facetedsearch/vendor/composer/autoload_real.php
560 /modules/ps_facetedsearch/vendor/composer/platform_check.php
561 /modules/ps_facetedsearch/vendor/composer/autoload_static.php
562 /modules/ps_emailalerts/vendor/autoload.php
563 /modules/ps_emailalerts/vendor/composer/autoload_real.php
564 /modules/ps_emailalerts/vendor/composer/autoload_static.php
565 /modules/ps_categorytree/vendor/autoload.php
566 /modules/ps_categorytree/vendor/composer/autoload_real.php
567 /modules/ps_categorytree/vendor/composer/platform_check.php
568 /modules/ps_categorytree/vendor/composer/autoload_static.php
569 /modules/ps_distributionapiclient/vendor/autoload.php
570 /modules/ps_distributionapiclient/vendor/composer/autoload_real.php
571 /modules/ps_distributionapiclient/vendor/composer/platform_check.php
572 /modules/ps_distributionapiclient/vendor/composer/autoload_static.php
573 /modules/ps_distributionapiclient/vendor/symfony/polyfill-intl-grapheme/bootstrap.php
574 /modules/ps_distributionapiclient/vendor/symfony/string/Resources/functions.php
575 /src/Core/Hook/HookModuleFilter.php
576 /src/Core/Hook/HookModuleFilterInterface.php
577 /controllers/front/listing/CategoryController.php
578 /classes/controller/ProductListingFrontController.php
579 /classes/controller/ProductPresentingFrontController.php
580 /classes/controller/FrontController.php
581 /src/PrestaShopBundle/Translation/TranslatorComponent.php
582 /vendor/symfony/symfony/src/Symfony/Component/Translation/Translator.php
583 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorInterface.php
584 /vendor/symfony/contracts/Translation/LocaleAwareInterface.php
585 /vendor/symfony/contracts/Translation/TranslatorInterface.php
586 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorBagInterface.php
587 /src/PrestaShopBundle/Translation/PrestaShopTranslatorTrait.php
588 /src/PrestaShopBundle/Translation/TranslatorLanguageTrait.php
589 /src/PrestaShopBundle/Translation/TranslatorInterface.php
590 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatter.php
591 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatter.php
592 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatterInterface.php
593 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatterInterface.php
594 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/ChoiceMessageFormatterInterface.php
595 /vendor/symfony/symfony/src/Symfony/Component/Translation/IdentityTranslator.php
596 /vendor/symfony/contracts/Translation/TranslatorTrait.php
597 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactory.php
598 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactoryInterface.php
599 /var/cache/prod/translations/catalogue.es-ES.NXhscRe.php
600 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogue.php
601 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogueInterface.php
602 /vendor/symfony/symfony/src/Symfony/Component/Translation/MetadataAwareInterface.php
603 /src/Adapter/Presenter/Object/ObjectPresenter.php
604 /src/Adapter/Presenter/PresenterInterface.php
605 /src/Adapter/Presenter/Cart/CartPresenter.php
606 /src/Adapter/Image/ImageRetriever.php
607 /classes/tax/TaxConfiguration.php
608 /classes/Smarty/TemplateFinder.php
609 /classes/assets/StylesheetManager.php
610 /classes/assets/AbstractAssetManager.php
611 /src/Adapter/Assets/AssetUrlGeneratorTrait.php
612 /classes/assets/JavascriptManager.php
613 /classes/assets/CccReducer.php
614 /modules/iqitthemeeditor/iqitthemeeditor.php
615 /modules/iqitthemeeditor/src/IqitSmartyModifiers.php
616 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_createdata.php
617 /vendor/smarty/smarty/libs/sysplugins/smarty_data.php
618 /classes/Translate.php
619 /modules/iqitthemeeditor/translations/es.php
620 /classes/Category.php
621 /classes/webservice/WebserviceRequest.php
622 /src/Core/Localization/Locale/Repository.php
623 /src/Core/Localization/Locale/RepositoryInterface.php
624 /src/Core/Localization/CLDR/LocaleRepository.php
625 /src/Core/Localization/CLDR/LocaleDataSource.php
626 /src/Core/Localization/CLDR/DataLayer/LocaleCache.php
627 /src/Core/Data/Layer/AbstractDataLayer.php
628 /src/Core/Localization/CLDR/LocaleDataLayerInterface.php
629 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/FilesystemAdapter.php
630 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AbstractAdapter.php
631 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractAdapterTrait.php
632 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractTrait.php
633 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ContractsTrait.php
634 /vendor/symfony/contracts/Cache/CacheTrait.php
635 /vendor/psr/cache/src/InvalidArgumentException.php
636 /vendor/psr/cache/src/CacheException.php
637 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemTrait.php
638 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemCommonTrait.php
639 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/DefaultMarshaller.php
640 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/MarshallerInterface.php
641 /src/Core/Localization/CLDR/DataLayer/LocaleReference.php
642 /src/Core/Localization/CLDR/Reader.php
643 /src/Core/Localization/CLDR/ReaderInterface.php
644 /src/Core/Localization/Currency/Repository.php
645 /src/Core/Localization/Currency/RepositoryInterface.php
646 /src/Core/Localization/Currency/CurrencyDataSource.php
647 /src/Core/Localization/Currency/DataSourceInterface.php
648 /src/Core/Localization/Currency/DataLayer/CurrencyCache.php
649 /src/Core/Localization/Currency/CurrencyDataLayerInterface.php
650 /src/Core/Localization/Currency/DataLayer/CurrencyDatabase.php
651 /src/Adapter/Currency/CurrencyDataProvider.php
652 /src/Core/Currency/CurrencyDataProviderInterface.php
653 /src/Adapter/LegacyContext.php
654 /src/Adapter/Tools.php
655 /src/Core/Localization/Currency/DataLayer/CurrencyReference.php
656 /src/Core/Localization/Currency/DataLayer/CurrencyInstalled.php
657 /vendor/prestashop/decimal/src/Operation/Rounding.php
658 /src/Core/Localization/Locale.php
659 /src/Core/Localization/LocaleInterface.php
660 /src/Core/Localization/Specification/Price.php
661 /src/Core/Localization/Specification/Number.php
662 /src/Core/Localization/Specification/NumberInterface.php
663 /src/Core/Localization/Specification/Factory.php
664 /src/Core/Localization/CLDR/LocaleData.php
665 /src/Core/Localization/CLDR/NumberSymbolsData.php
666 /src/Core/Localization/CLDR/CurrencyData.php
667 /src/Core/Localization/CLDR/Locale.php
668 /src/Core/Localization/CLDR/LocaleInterface.php
669 /src/Core/Localization/Specification/NumberSymbolList.php
670 /classes/Currency.php
671 /src/Core/Localization/Currency/LocalizedCurrencyId.php
672 /src/Core/Localization/Currency/CurrencyData.php
673 /src/Core/Localization/Currency/CurrencyCollection.php
674 /src/Core/Localization/Currency.php
675 /src/Core/Localization/CurrencyInterface.php
676 /src/Core/Localization/Specification/NumberCollection.php
677 /src/Core/Localization/Number/Formatter.php
678 /classes/Cart.php
679 /src/Adapter/AddressFactory.php
680 /classes/CartRule.php
681 /classes/Product.php
682 /src/Core/Domain/Product/ValueObject/RedirectType.php
683 /src/Core/Util/DateTime/DateTime.php
684 /src/Core/Domain/Product/Stock/ValueObject/OutOfStockType.php
685 /src/Core/Domain/Product/Pack/ValueObject/PackStockType.php
686 /src/Core/Domain/Product/ValueObject/ProductType.php
687 /src/Core/Domain/Product/ValueObject/Reference.php
688 /src/Core/Domain/Product/ValueObject/Ean13.php
689 /src/Core/Domain/Product/ValueObject/Isbn.php
690 /src/Core/Domain/Product/ValueObject/Upc.php
691 /src/Core/Domain/Product/ProductSettings.php
692 /src/Core/Image/ImageFormatConfiguration.php
693 /src/Core/Image/ImageFormatConfigurationInterface.php
694 /classes/FeatureFlag.php
695 /src/Core/FeatureFlag/FeatureFlagSettings.php
696 /classes/ImageType.php
697 /src/Core/Domain/Shop/ValueObject/ShopId.php
698 /src/Core/Domain/Shop/ValueObject/ShopIdInterface.php
699 /modules/ps_emailsubscription/ps_emailsubscription.php
700 /src/Core/Module/WidgetInterface.php
701 /src/PrestaShopBundle/Translation/DomainNormalizer.php
702 /classes/Media.php
703 /modules/ps_facebook/ps_facebook.php
704 /modules/ps_facebook/translations/es.php
705 /modules/ps_metrics/vendor/prestashop/module-lib-service-container/src/DependencyInjection/ServiceContainer.php
706 /modules/ps_metrics/vendor/prestashop/module-lib-cache-directory-provider/src/Cache/CacheDirectoryProvider.php
707 /modules/ps_metrics/vendor/prestashop/module-lib-service-container/src/DependencyInjection/ContainerProvider.php
708 /var/cache/prod/Ps_facebookFrontContainer.php
709 /modules/ps_facebook/classes/Buffer/TemplateBuffer.php
710 /modules/ps_emailalerts/ps_emailalerts.php
711 /modules/ps_emailalerts/MailAlert.php
712 /src/Adapter/Presenter/Cart/CartLazyArray.php
713 /src/Adapter/Presenter/AbstractLazyArray.php
714 /src/Adapter/Product/PriceFormatter.php
715 /src/Core/Util/Inflector.php
716 /vendor/doctrine/inflector/lib/Doctrine/Inflector/InflectorFactory.php
717 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Language.php
718 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/InflectorFactory.php
719 /vendor/doctrine/inflector/lib/Doctrine/Inflector/GenericLanguageInflectorFactory.php
720 /vendor/doctrine/inflector/lib/Doctrine/Inflector/LanguageInflectorFactory.php
721 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Rules.php
722 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Ruleset.php
723 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformations.php
724 /vendor/doctrine/inflector/lib/Doctrine/Inflector/WordInflector.php
725 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Inflectible.php
726 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformation.php
727 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Pattern.php
728 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Patterns.php
729 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Uninflected.php
730 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitutions.php
731 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitution.php
732 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Word.php
733 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Inflector.php
734 /vendor/doctrine/inflector/lib/Doctrine/Inflector/CachedWordInflector.php
735 /vendor/doctrine/inflector/lib/Doctrine/Inflector/RulesetInflector.php
736 /classes/Gender.php
737 /classes/Risk.php
738 /classes/Meta.php
739 /classes/Address.php
740 /classes/State.php
741 /src/Core/Security/PasswordPolicyConfiguration.php
742 /src/Core/Configuration/DataConfigurationInterface.php
743 /src/Core/Security/Hashing.php
744 /src/Core/Filter/FrontEndObject/MainFilter.php
745 /src/Core/Filter/FilterInterface.php
746 /src/Core/Filter/FrontEndObject/CartFilter.php
747 /src/Core/Filter/HashMapWhitelistFilter.php
748 /src/Core/Filter/CollectionFilter.php
749 /src/Core/Filter/FrontEndObject/ProductFilter.php
750 /src/Core/Filter/FrontEndObject/EmbeddedAttributesFilter.php
751 /src/Core/Filter/FrontEndObject/CustomerFilter.php
752 /src/Core/Filter/FrontEndObject/ShopFilter.php
753 /src/Core/Filter/FrontEndObject/ConfigurationFilter.php
754 /modules/productcomments/productcomments.php
755 /modules/ps_shoppingcart/ps_shoppingcart.php
756 /modules/ps_facebook/classes/Handler/ErrorHandler/ErrorHandler.php
757 /modules/ps_facebook/classes/Config/Env.php
758 /modules/ps_facebook/classes/Handler/ErrorHandler/ModuleFilteredRavenClient.php
759 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/Client.php
760 /modules/ps_facebook/classes/Config/Config.php
761 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/Util.php
762 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/Compat.php
763 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/Processor/SanitizeDataProcessor.php
764 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/Processor.php
765 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/Context.php
766 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/Breadcrumbs.php
767 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/Serializer.php
768 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/ReprSerializer.php
769 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/TransactionStack.php
770 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/Breadcrumbs/ErrorHandler.php
771 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/Stacktrace.php
772 /modules/ps_facebook/vendor/prestashop/prestashop-accounts-installer/src/Installer/Facade/PsAccounts.php
773 /modules/ps_facebook/vendor/prestashop/prestashop-accounts-installer/src/Installer/Installer.php
774 /src/Core/Addon/Module/ModuleManagerBuilder.php
775 /src/Core/Util/File/YamlParser.php
776 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/SelfCheckingResourceChecker.php
777 /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerInterface.php
778 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/FileResource.php
779 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/SelfCheckingResourceInterface.php
780 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/ResourceInterface.php
781 /var/cache/prod/yaml/b57b1d618dfd4975fcf38dbdde58e4aa.php
782 /src/Adapter/LegacyLogger.php
783 /src/PrestaShopBundle/Service/DataProvider/Admin/CategoriesProvider.php
784 /src/Adapter/Module/ModuleDataProvider.php
785 /src/Adapter/Module/AdminModuleDataProvider.php
786 /src/PrestaShopBundle/Service/DataProvider/Admin/ModuleInterface.php
787 /src/Adapter/Module/Module.php
788 /src/Core/Module/ModuleInterface.php
789 /vendor/symfony/symfony/src/Symfony/Component/Config/FileLocator.php
790 /vendor/symfony/symfony/src/Symfony/Component/Config/FileLocatorInterface.php
791 /vendor/symfony/symfony/src/Symfony/Component/Routing/Loader/YamlFileLoader.php
792 /vendor/symfony/symfony/src/Symfony/Component/Config/Loader/FileLoader.php
793 /vendor/symfony/symfony/src/Symfony/Component/Config/Loader/Loader.php
794 /vendor/symfony/symfony/src/Symfony/Component/Config/Loader/LoaderInterface.php
795 /vendor/symfony/symfony/src/Symfony/Component/Routing/Router.php
796 /vendor/symfony/symfony/src/Symfony/Component/Routing/RouterInterface.php
797 /vendor/symfony/symfony/src/Symfony/Component/Routing/Matcher/UrlMatcherInterface.php
798 /vendor/symfony/symfony/src/Symfony/Component/Routing/RequestContextAwareInterface.php
799 /vendor/symfony/symfony/src/Symfony/Component/Routing/Generator/UrlGeneratorInterface.php
800 /vendor/symfony/symfony/src/Symfony/Component/Routing/Matcher/RequestMatcherInterface.php
801 /vendor/symfony/symfony/src/Symfony/Component/Routing/RequestContext.php
802 /src/Adapter/Module/ModuleDataUpdater.php
803 /src/Core/Module/ModuleManager.php
804 /src/Core/Module/ModuleManagerInterface.php
805 /src/Core/Module/ModuleRepository.php
806 /src/Core/Module/ModuleRepositoryInterface.php
807 /src/Adapter/HookManager.php
808 /src/Core/Module/SourceHandler/SourceHandlerFactory.php
809 /src/PrestaShopBundle/Event/Dispatcher/NullDispatcher.php
810 /vendor/symfony/symfony/src/Symfony/Component/EventDispatcher/EventDispatcherInterface.php
811 /vendor/symfony/contracts/EventDispatcher/EventDispatcherInterface.php
812 /modules/ps_metrics/vendor/psr/event-dispatcher/src/EventDispatcherInterface.php
813 /src/Core/Hook/HookDispatcherInterface.php
814 /modules/ps_accounts/ps_accounts.php
815 /modules/ps_accounts/vendor/autoload.php
816 /modules/ps_accounts/vendor/composer/autoload_real.php
817 /modules/ps_accounts/vendor/composer/platform_check.php
818 /modules/ps_accounts/vendor/composer/autoload_static.php
819 /modules/ps_accounts/vendor/paragonie/random_compat/lib/random.php
820 /modules/ps_accounts/vendor/symfony/polyfill-ctype/bootstrap.php
821 /modules/ps_accounts/vendor/lcobucci/jwt/compat/class-aliases.php
822 /modules/ps_accounts/vendor/lcobucci/jwt/src/Token.php
823 /modules/ps_accounts/vendor/lcobucci/jwt/src/Signature.php
824 /modules/ps_accounts/vendor/lcobucci/jwt/compat/json-exception-polyfill.php
825 /modules/ps_accounts/vendor/lcobucci/jwt/compat/lcobucci-clock-polyfill.php
826 /modules/ps_accounts/vendor/ramsey/uuid/src/functions.php
827 /modules/ps_accounts/src/Hook/HookableTrait.php
828 /modules/ps_accounts/src/Module/Install.php
829 /modules/ps_accounts/src/Settings/SettingsForm.php
830 /modules/ps_accounts/translations/es.php
831 /modules/ps_accounts/src/ServiceContainer/PsAccountsContainer.php
832 /modules/ps_accounts/vendor/prestashopcorp/lightweight-container/src/ServiceContainer/ServiceContainer.php
833 /modules/ps_accounts/config.php
834 /modules/ps_accounts/src/Log/Logger.php
835 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Logger.php
836 /modules/ps_accounts/vendor/psr/log/Psr/Log/LoggerInterface.php
837 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/ResettableInterface.php
838 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Handler/RotatingFileHandler.php
839 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Handler/StreamHandler.php
840 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Handler/AbstractProcessingHandler.php
841 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Handler/AbstractHandler.php
842 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Handler/HandlerInterface.php
843 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Utils.php
844 /modules/ps_accounts/src/ServiceProvider/ApiClientProvider.php
845 /modules/ps_accounts/vendor/prestashopcorp/lightweight-container/src/ServiceContainer/Contract/IServiceProvider.php
846 /modules/ps_accounts/src/ServiceProvider/CommandProvider.php
847 /modules/ps_accounts/src/ServiceProvider/DefaultProvider.php
848 /modules/ps_accounts/src/ServiceProvider/OAuth2Provider.php
849 /modules/ps_accounts/src/ServiceProvider/QueryProvider.php
850 /modules/ps_accounts/src/ServiceProvider/RepositoryProvider.php
851 /modules/ps_accounts/src/ServiceProvider/SessionProvider.php
852 /modules/ps_accounts/src/Service/PsAccountsService.php
853 /modules/ps_accounts/src/Account/Session/ShopSession.php
854 /modules/ps_accounts/src/Account/Session/Session.php
855 /modules/ps_accounts/src/Account/Session/SessionInterface.php
856 /modules/ps_accounts/src/Repository/ConfigurationRepository.php
857 /modules/ps_accounts/src/Adapter/Configuration.php
858 /modules/ps_accounts/src/Service/OAuth2/OAuth2Service.php
859 /modules/ps_accounts/src/Http/Client/ClientConfig.php
860 /modules/ps_accounts/src/Http/Client/ConfigObject.php
861 /modules/ps_accounts/src/Type/Enum.php
862 /modules/ps_accounts/src/Service/OAuth2/OAuth2Client.php
863 /modules/ps_accounts/src/Adapter/Link.php
864 /modules/ps_accounts/src/Context/ShopContext.php
865 /modules/ps_accounts/vendor/ramsey/uuid/src/Uuid.php
866 /modules/ps_accounts/vendor/ramsey/uuid/src/UuidInterface.php
867 /modules/ps_accounts/vendor/ramsey/uuid/src/UuidFactory.php
868 /modules/ps_accounts/vendor/ramsey/uuid/src/UuidFactoryInterface.php
869 /modules/ps_accounts/vendor/ramsey/uuid/src/FeatureSet.php
870 /modules/ps_accounts/vendor/ramsey/uuid/src/Converter/Number/DegradedNumberConverter.php
871 /modules/ps_accounts/vendor/ramsey/uuid/src/Converter/NumberConverterInterface.php
872 /modules/ps_accounts/vendor/ramsey/uuid/src/Builder/DefaultUuidBuilder.php
873 /modules/ps_accounts/vendor/ramsey/uuid/src/Builder/UuidBuilderInterface.php
874 /modules/ps_accounts/vendor/ramsey/uuid/src/Codec/StringCodec.php
875 /modules/ps_accounts/vendor/ramsey/uuid/src/Codec/CodecInterface.php
876 /modules/ps_accounts/vendor/ramsey/uuid/src/Provider/Node/FallbackNodeProvider.php
877 /modules/ps_accounts/vendor/ramsey/uuid/src/Provider/NodeProviderInterface.php
878 /modules/ps_accounts/vendor/ramsey/uuid/src/Provider/Node/SystemNodeProvider.php
879 /modules/ps_accounts/vendor/ramsey/uuid/src/Provider/Node/RandomNodeProvider.php
880 /modules/ps_accounts/vendor/ramsey/uuid/src/Generator/RandomGeneratorFactory.php
881 /modules/ps_accounts/vendor/ramsey/uuid/src/Generator/RandomBytesGenerator.php
882 /modules/ps_accounts/vendor/ramsey/uuid/src/Generator/RandomGeneratorInterface.php
883 /modules/ps_accounts/vendor/ramsey/uuid/src/Provider/Time/SystemTimeProvider.php
884 /modules/ps_accounts/vendor/ramsey/uuid/src/Provider/TimeProviderInterface.php
885 /modules/ps_accounts/vendor/ramsey/uuid/src/Generator/TimeGeneratorFactory.php
886 /modules/ps_accounts/vendor/ramsey/uuid/src/Converter/Time/PhpTimeConverter.php
887 /modules/ps_accounts/vendor/ramsey/uuid/src/Converter/TimeConverterInterface.php
888 /modules/ps_accounts/vendor/ramsey/uuid/src/Generator/DefaultTimeGenerator.php
889 /modules/ps_accounts/vendor/ramsey/uuid/src/Generator/TimeGeneratorInterface.php
890 /modules/ps_accounts/vendor/ramsey/uuid/src/BinaryUtils.php
891 /modules/ps_accounts/src/Service/OAuth2/CachedFile.php
892 /modules/ps_accounts/src/Account/Session/Firebase/ShopSession.php
893 /modules/ps_accounts/src/Account/Session/Firebase/FirebaseSession.php
894 /modules/ps_accounts/src/Account/Session/Firebase/OwnerSession.php
895 /modules/ps_accounts/src/Account/StatusManager.php
896 /modules/ps_accounts/src/Traits/WithOriginAndSourceTrait.php
897 /modules/ps_accounts/src/Traits/WithPropertyTrait.php
898 /modules/ps_accounts/src/Service/Accounts/AccountsService.php
899 /modules/ps_accounts/src/Service/AnalyticsService.php
900 /modules/ps_accounts/src/Service/AdminTokenService.php
901 /modules/ps_accounts/src/Adapter/ConfigurationKeys.php
902 /modules/ps_accounts/src/Account/CachedShopStatus.php
903 /modules/ps_accounts/src/Http/Resource/Resource.php
904 /modules/ps_accounts/src/Type/Dto.php
905 /modules/ps_accounts/src/Service/Accounts/Resource/ShopStatus.php
906 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/ErrorHandler.php
907 /modules/ps_facebook/classes/Dispatcher/EventDispatcher.php
908 /modules/ps_facebook/classes/Handler/ApiConversionHandler.php
909 /modules/ps_facebook/classes/Adapter/ConfigurationAdapter.php
910 /modules/ps_facebook/classes/Factory/ContextFactory.php
911 /modules/ps_facebook/classes/API/Client/FacebookClient.php
912 /modules/ps_facebook/classes/Factory/FacebookEssentialsApiClientFactory.php
913 /modules/ps_facebook/classes/Factory/ApiClientFactoryInterface.php
914 /modules/ps_facebook/classes/Provider/AccessTokenProvider.php
915 /modules/ps_facebook/classes/Factory/PsApiClientFactory.php
916 /modules/ps_facebook/classes/Handler/ConfigurationHandler.php
917 /modules/ps_facebook/classes/Http/HttpClient.php
918 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Api.php
919 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Session.php
920 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/SessionInterface.php
921 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/ApiConfig.php
922 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/Client.php
923 /modules/ps_facebook/classes/Handler/PixelHandler.php
924 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/MockFileSessionStorage.php
925 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/MockArraySessionStorage.php
926 /modules/ps_facebook/classes/Provider/EventDataProvider.php
927 /modules/ps_facebook/classes/Adapter/ToolsAdapter.php
928 /modules/ps_facebook/classes/Repository/ProductRepository.php
929 /modules/ps_facebook/classes/Provider/ProductAvailabilityProvider.php
930 /modules/ps_facebook/classes/Provider/ProductAvailabilityProviderInterface.php
931 /modules/ps_facebook/classes/Repository/GoogleCategoryRepository.php
932 /modules/ps_facebook/classes/Provider/GoogleCategoryProvider.php
933 /modules/ps_facebook/classes/Provider/GoogleCategoryProviderInterface.php
934 /classes/Combination.php
935 /classes/stock/StockAvailable.php
936 /classes/tax/Tax.php
937 /vendor/prestashop/decimal/src/DecimalNumber.php
938 /vendor/prestashop/decimal/src/Builder.php
939 /classes/SpecificPrice.php
940 /classes/tax/TaxManagerFactory.php
941 /classes/tax/TaxRulesTaxManager.php
942 /classes/tax/TaxManagerInterface.php
943 /classes/tax/TaxCalculator.php
944 /classes/GroupReduction.php
945 /src/Core/Localization/CLDR/ComputingPrecision.php
946 /src/Core/Localization/CLDR/ComputingPrecisionInterface.php
947 /classes/Pack.php
948 /classes/order/Order.php
949 /classes/Feature.php
950 /src/Core/Domain/Combination/CombinationSettings.php
951 /modules/ps_facebook/classes/Utility/ProductCatalogUtility.php
952 /src/Core/Util/String/StringModifier.php
953 /src/Core/Util/String/StringModifierInterface.php
954 /modules/ps_facebook/classes/Utility/CustomerInformationUtility.php
955 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/ServerSide/UserData.php
956 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/ServerSide/CustomData.php
957 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/ServerSide/Event.php
958 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/ServerSide/ActionSource.php
959 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Enum/AbstractEnum.php
960 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Enum/EnumInstanceInterface.php
961 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/ServerSide/EventRequest.php
962 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/ServerSide/HttpServiceClientConfig.php
963 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/ServerSide/Singleton.php
964 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/ServerSide/Util.php
965 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/ServerSide/Normalizer.php
966 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/AdsPixel.php
967 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/AbstractCrudObject.php
968 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/AbstractObject.php
969 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/Fields/AdsPixelFields.php
970 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/TypeChecker.php
971 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/Values/AdsPixelSortByValues.php
972 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/Values/AdsPixelAutomaticMatchingFieldsValues.php
973 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/Values/AdsPixelDataUseSettingValues.php
974 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/Values/AdsPixelFirstPartyCookieStatusValues.php
975 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/Values/AdsPixelPermittedTasksValues.php
976 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/Values/AdsPixelTasksValues.php
977 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/ApiRequest.php
978 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/RequestInterface.php
979 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Enum/EmptyEnum.php
980 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/Request.php
981 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/Parameters.php
982 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Logger/NullLogger.php
983 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Logger/LoggerInterface.php
984 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/Adapter/CurlAdapter.php
985 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/Adapter/AbstractAdapter.php
986 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/Adapter/AdapterInterface.php
987 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/Adapter/Curl/AbstractCurl.php
988 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/Adapter/Curl/CurlInterface.php
989 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/Adapter/Curl/Curl55.php
990 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/Response.php
991 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/ResponseInterface.php
992 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/Headers.php
993 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/ServerSide/EventResponse.php
994 /vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php
995 /var/cache/prod/smarty/compile/warehouse/7b/d6/67/7bd6674da24c9dfe787a4ab6d9f95992772bfd39_2.file.header.tpl.php
996 /vendor/smarty/smarty/libs/plugins/modifier.escape.php
997 /var/cache/prod/smarty/compile/warehouse/e4/c2/28/e4c22868c11d8c62c1db61f765dd994d1dfa43b9_2.file.fbTrack.tpl.php
998 /modules/psxmarketingwithgoogle/psxmarketingwithgoogle.php
999 /modules/psxmarketingwithgoogle/translations/es.php
1000 /var/cache/prod/PsxmarketingwithgoogleFrontContainer.php
1001 /modules/psxmarketingwithgoogle/classes/Adapter/ConfigurationAdapter.php
1002 /modules/psxmarketingwithgoogle/classes/Factory/ContextFactory.php
1003 /modules/psxmarketingwithgoogle/classes/config/Config.php
1004 /modules/psxmarketingwithgoogle/classes/Handler/RemarketingHookHandler.php
1005 /modules/psxmarketingwithgoogle/classes/Buffer/TemplateBuffer.php
1006 /modules/iqitcookielaw/iqitcookielaw.php
1007 /modules/iqitcookielaw/translations/es.php
1008 /modules/iqitmegamenu/iqitmegamenu.php
1009 /modules/iqitmegamenu/models/IqitMenuTab.php
1010 /modules/iqitmegamenu/models/IqitMenuHtml.php
1011 /modules/iqitmegamenu/models/IqitMenuLinks.php
1012 /modules/iqitmegamenu/translations/es.php
1013 /modules/iqitelementor/iqitelementor.php
1014 /modules/iqitelementor/src/IqitElementorLanding.php
1015 /modules/iqitelementor/src/IqitElementorTemplate.php
1016 /modules/iqitelementor/src/IqitElementorProduct.php
1017 /modules/iqitelementor/src/IqitElementorCategory.php
1018 /modules/iqitelementor/src/IqitElementorContent.php
1019 /modules/iqitelementor/src/iqitElementorWpHelper.php
1020 /modules/iqitelementor/includes/plugin-elementor.php
1021 /modules/iqitelementor/src/widgets/IqitElementorWidget_Brands.php
1022 /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsList.php
1023 /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsListTabs.php
1024 /modules/iqitelementor/src/widgets/IqitElementorWidget_Modules.php
1025 /modules/iqitelementor/src/widgets/IqitElementorWidget_CustomTpl.php
1026 /modules/iqitelementor/src/widgets/IqitElementorWidget_Menu.php
1027 /modules/iqitelementor/src/widgets/IqitElementorWidget_RevolutionSlider.php
1028 /modules/iqitelementor/src/widgets/IqitElementorWidget_Newsletter.php
1029 /modules/iqitelementor/src/widgets/IqitElementorWidget_Blog.php
1030 /modules/iqitelementor/src/widgets/IqitElementorWidget_Search.php
1031 /modules/iqitelementor/src/widgets/IqitElementorWidget_Links.php
1032 /modules/iqitelementor/src/widgets/IqitElementorWidget_ContactForm.php
1033 /modules/iqitelementor/translations/es.php
1034 /modules/nacex/nacex.php
1035 /modules/nacex/nacexWS.php
1036 /modules/nacex/nacexDTO.php
1037 /modules/nacex/AdminConfig.php
1038 /modules/nacex/UserGuide.php
1039 /modules/nacex/VInewServices.php
1040 /modules/nacex/nacexutils.php
1041 /modules/nacex/LBnewService.php
1042 /modules/nacex/nacexDAO.php
1043 /modules/nacex/ROnacexshop.php
1044 /modules/nacex/tratardatos.php
1045 /modules/nacex/nacexVIEW.php
1046 /modules/nacex/hash.php
1047 /classes/module/CarrierModule.php
1048 /modules/nacex/translations/es.php
1049 /src/Core/Product/Search/ProductSearchContext.php
1050 /src/Core/Product/Search/ProductSearchQuery.php
1051 /src/Core/Product/Search/SortOrder.php
1052 /modules/ps_facetedsearch/ps_facetedsearch.php
1053 /modules/ps_facetedsearch/src/HookDispatcher.php
1054 /modules/ps_facetedsearch/src/Hook/Attribute.php
1055 /modules/ps_facetedsearch/src/Hook/AbstractHook.php
1056 /modules/ps_facetedsearch/src/Hook/AttributeGroup.php
1057 /modules/ps_facetedsearch/src/Hook/Category.php
1058 /modules/ps_facetedsearch/src/Hook/Configuration.php
1059 /modules/ps_facetedsearch/src/Hook/Design.php
1060 /modules/ps_facetedsearch/src/Hook/Feature.php
1061 /modules/ps_facetedsearch/src/Form/Feature/FormModifier.php
1062 /modules/ps_facetedsearch/src/Form/Feature/FormDataProvider.php
1063 /modules/ps_facetedsearch/src/Hook/FeatureValue.php
1064 /modules/ps_facetedsearch/src/Form/FeatureValue/FormModifier.php
1065 /modules/ps_facetedsearch/src/Form/FeatureValue/FormDataProvider.php
1066 /modules/ps_facetedsearch/src/Hook/Product.php
1067 /modules/ps_facetedsearch/src/Hook/ProductSearch.php
1068 /modules/ps_facetedsearch/src/Hook/SpecificPrice.php
1069 /modules/ps_facetedsearch/src/Filters/Provider.php
1070 /modules/ps_facetedsearch/src/URLSerializer.php
1071 /modules/ps_facetedsearch/src/Filters/DataAccessor.php
1072 /modules/ps_facetedsearch/src/Product/SearchProvider.php
1073 /src/Core/Product/Search/FacetsRendererInterface.php
1074 /src/Core/Product/Search/ProductSearchProviderInterface.php
1075 /modules/ps_facetedsearch/src/Filters/Converter.php
1076 /modules/ps_facetedsearch/src/Product/SearchFactory.php
1077 /src/Core/Product/Search/ProductSearchResult.php
1078 /modules/ps_facetedsearch/src/Product/Search.php
1079 /modules/ps_facetedsearch/src/Adapter/MySQL.php
1080 /modules/ps_facetedsearch/src/Adapter/AbstractAdapter.php
1081 /modules/ps_facetedsearch/src/Adapter/InterfaceAdapter.php
1082 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ArrayCollection.php
1083 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Collection.php
1084 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ReadableCollection.php
1085 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Selectable.php
1086 /modules/ps_facetedsearch/src/Filters/Products.php
1087 /modules/ps_facetedsearch/src/Filters/Block.php
1088 /src/Core/Product/Search/Facet.php
1089 /src/Core/Product/Search/Filter.php
1090 /src/Core/Product/Search/FacetCollection.php
1091 /classes/ProductAssembler.php
1092 /classes/Manufacturer.php
1093 /classes/ProductPresenterFactory.php
1094 /src/Adapter/Presenter/Product/ProductListingPresenter.php
1095 /src/Adapter/Presenter/Product/ProductPresenter.php
1096 /src/Adapter/Product/ProductColorsRetriever.php
1097 /src/Core/Product/ProductPresentationSettings.php
1098 /src/Adapter/Presenter/Product/ProductListingLazyArray.php
1099 /src/Adapter/Presenter/Product/ProductLazyArray.php
1100 /classes/Image.php
1101 /var/cache/prod/smarty/compile/warehouse/d4/1d/65/d41d65d76b9471b5d365fe06cf1737c89a53af9f_2.module.ps_facetedsearchviewstemplatesfrontcatalogfacets.tpl.php
1102 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_block.php
1103 /vendor/smarty/smarty/libs/plugins/modifier.count.php
1104 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php
1105 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_foreach.php
1106 /var/cache/prod/smarty/compile/warehouse/2e/80/73/2e807335546cfa2360c36327ac89dd2fcb054379_2.module.ps_facetedsearchviewstemplatesfrontcatalogactivefilters.tpl.php
1107 /src/Core/Product/Search/Pagination.php
1108 /vendor/defuse/php-encryption/src/Crypto.php
1109 /vendor/defuse/php-encryption/src/KeyOrPassword.php
1110 /vendor/defuse/php-encryption/src/RuntimeTests.php
1111 /vendor/defuse/php-encryption/src/DerivedKeys.php
1112 /vendor/defuse/php-encryption/src/Exception/WrongKeyOrModifiedCiphertextException.php
1113 /vendor/defuse/php-encryption/src/Exception/CryptoException.php
1114 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/75/a6/42/75a64202e97931196bc7ffc62f78ffd65260f53c_2.file.category.tpl.php
1115 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_capture.php
1116 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/94/12/cc/9412ccef9680927153b45c6ae144d544996206b6_2.file.product-list.tpl.php
1117 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/b9/42/2f/b9422fde64d87165f5f5c624a4cbefbe5f5cc591_2.file.layout-left-column.tpl.php
1118 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/d2/95/d8/d295d85097e23dfc619a6d9948f9bb0871953825_2.file.layout-both-columns.tpl.php
1119 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/48/f1/3f/48f13f505ce53fe1a91e5a59ff252495434ac43d_2.file.helpers.tpl.php
1120 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_tplfunction.php
1121 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/1b/22/bc/1b22bcae0a59cc6b48cc1c9c25235f501651e518_2.file.head.tpl.php
1122 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/41/92/2e/41922ed228227013af99527db113ad08c91d4c9b_2.file.head-jsonld.tpl.php
1123 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/e2/41/5c/e2415c4af2ebd285942a955984af4b4e1aa22189_2.file.product-list-jsonld.tpl.php
1124 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/04/1b/47/041b4759bcd23a9de0adfa67f3a43b8b64636a07_2.file.pagination-seo.tpl.php
1125 /vendor/smarty/smarty/libs/plugins/modifier.replace.php
1126 /vendor/smarty/smarty/libs/plugins/shared.mb_str_replace.php
1127 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/43/32/e4/4332e4a9374e52ec03407d255e0717700fe0ae38_2.file.stylesheets.tpl.php
1128 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/ad/11/eb/ad11ebbbe1d132c2eb222c363cd04b3dee98d8fb_2.file.javascript.tpl.php
1129 /classes/ProductDownload.php
1130 /src/Core/Cart/Calculator.php
1131 /src/Core/Cart/CartRowCollection.php
1132 /src/Core/Cart/Fees.php
1133 /src/Core/Cart/AmountImmutable.php
1134 /src/Core/Cart/CartRuleCollection.php
1135 /src/Core/Cart/CartRuleCalculator.php
1136 /src/Adapter/Product/PriceCalculator.php
1137 /src/Core/Cart/CartRow.php
1138 /vendor/symfony/symfony/src/Symfony/Component/Translation/PluralizationRules.php
1139 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/b3/9c/46/b39c46fe99acdbe1574e9b876a398a0024152c16_2.file.product-activation.tpl.php
1140 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/da/79/cf/da79cf6aab6675d177369043b59a83d42869b4f0_2.file.header.tpl.php
1141 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/6a/a2/df/6aa2dfd27b196571f30e719112e04b70f089f033_2.file.social-links.tpl.php
1142 /modules/iqitlinksmanager/iqitlinksmanager.php
1143 /modules/iqitlinksmanager/src/IqitLinkBlockRepository.php
1144 /modules/iqitlinksmanager/src/IqitLinkBlock.php
1145 /modules/iqitlinksmanager/src/IqitLinkBlockPresenter.php
1146 /modules/iqitlinksmanager/translations/es.php
1147 /vendor/smarty/smarty/libs/sysplugins/smarty_template_cached.php
1148 /vendor/smarty/smarty/libs/sysplugins/smarty_cacheresource.php
1149 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_cacheresource_file.php
1150 /var/cache/prod/smarty/cache/iqitlinksmanager/1/1/1/6/displayNav1/warehouse/00/9f/22/009f22a54fda4ac75973e63c46f0132b1119ba03.iqitlinksmanagerviewstemplateshookiqitlinksmanager.tpl.php
1151 /modules/ps_languageselector/ps_languageselector.php
1152 /modules/ps_currencyselector/ps_currencyselector.php
1153 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/08/d5/04/08d504d7a022befca93803f3e17505b861ca8248_2.file.header-3.tpl.php
1154 /modules/iqitsearch/iqitsearch.php
1155 /modules/iqitsearch/translations/es.php
1156 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_gettemplatevars.php
1157 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/d9/9b/94/d99b947421dcff226f28b1d6cb674c91f17399db_2.module.iqitsearchviewstemplateshookiqitsearchbtn.tpl.php
1158 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/46/29/db/4629dbb3c4efa13c090c633dc2e46e5f2b42bed3_2.module.iqitsearchviewstemplateshooksearchbar.tpl.php
1159 /modules/ps_customersignin/ps_customersignin.php
1160 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/72/be/19/72be192e406191c1cad554abe284e159adeb4234_2.module.ps_customersigninps_customersigninbtn.tpl.php
1161 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/b4/a4/76/b4a476e0a8201677b298f7c0f8ca1ac698e1bac3_2.module.ps_shoppingcartps_shoppingcartbtn.tpl.php
1162 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/35/65/5e/35655e6409b6198f29dd6e732ef9598dec599880_2.module.ps_shoppingcartps_shoppingcart.tpl.php
1163 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/f6/e9/f2/f6e9f2b1680a466582d2199d038efe2cfa3a83f7_2.module.ps_shoppingcartps_shoppingcartcontent.tpl.php
1164 /var/cache/prod/smarty/cache/iqitmegamenu/index/1/1/1/6/warehouse/0e/3d/e6/0e3de6994bee6e3198146e208ce6beab444c9b4c.iqitmegamenuviewstemplateshookhorizontal.tpl.php
1165 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/cc/19/65/cc196527306127f5e0d92c634bf0405f2119a661_2.file.mobile-header-2.tpl.php
1166 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/7a/30/38/7a3038780284d52e9fcd7a66e51e5b86a166106b_2.module.iqitsearchviewstemplateshooksearchbarmobile.tpl.php
1167 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/be/ee/e6/beeee6f3d87613010f8af1cabc4c4562f8cf600a_2.module.ps_customersigninps_customersigninmobile.tpl.php
1168 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/d4/e1/57/d4e1571b6b210795247564db06deb17061778b51_2.module.ps_shoppingcartps_shoppingcartmqty.tpl.php
1169 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/90/d8/0a/90d80a9022c08011c7d753c6c3e409a4ae5b7fda_2.file.breadcrumb.tpl.php
1170 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/19/19/82/191982fa1e9d343688d9b381fea21c314a7ebef3_2.file.notifications.tpl.php
1171 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/3f/08/79/3f087969496cb1217bbe01ca6f95bbcaae18b1cf_2.file.category-header.tpl.php
1172 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/3e/fc/5c/3efc5c6cabf68a518dde9956926db6cf60a93dd5_2.file.products-top.tpl.php
1173 /vendor/smarty/smarty/libs/plugins/modifier.regex_replace.php
1174 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/5e/be/46/5ebe46ba384c4e31c6497e544847aec50e2df7ed_2.file.sort-orders.tpl.php
1175 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/df/95/52/df9552fec00c67a219e4d30c27efc6f3e649e435_2.file.products.tpl.php
1176 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/55/7a/be/557abe380aacf1dcc82a9614401a41c90059c373_2.file.product.tpl.php
1177 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/83/21/1d/83211d3e18c7848aecc64c18474f33bc0ea7cd65_2.file.product-miniature-1.tpl.php
1178 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/0a/d6/ba/0ad6ba9370f144df31a3308c307c61383af0f46f_2.file.product-miniature-thumb.tpl.php
1179 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/54/f1/31/54f131cbfede74c5ff970f4d07b4366036e2f8db_2.file.product-miniature-btn.tpl.php
1180 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/c2/18/5e/c2185e235e559bf004db69cd2c6a7703df41adb0_2.file.pagination.tpl.php
1181 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/5e/fc/91/5efc91d7387e3670df18e3cf6645652c4546f7c9_2.file.products-bottom.tpl.php
1182 /var/cache/prod/smarty/compile/warehouse/81/a1/04/81a1040ed0eeab6f58198f9907167c7fced628c5_2.module.ps_facetedsearchps_facetedsearch.tpl.php
1183 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/36/7c/da/367cdad5e95c9d0937b2526e141cbe7cc11d72f9_2.file.footer.tpl.php
1184 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/2c/ca/be/2ccabe66f524058310a6818abce4e6d56ee1bb64_2.file.footer-1.tpl.php
1185 /var/cache/prod/smarty/cache/iqitlinksmanager/1/1/1/6/displayFooter/warehouse/00/9f/22/009f22a54fda4ac75973e63c46f0132b1119ba03.iqitlinksmanagerviewstemplateshookiqitlinksmanager.tpl.php
1186 /modules/corewhatsapp/corewhatsapp.php
1187 /modules/corewhatsapp/classes/Corewhatsapp.php
1188 /var/cache/prod/smarty/compile/warehouse/f3/d9/ed/f3d9ed074127cff4b22b15d975f7cd788fe3a35d_2.file.corewhatsapp.tpl.php
1189 /var/cache/prod/smarty/compile/warehouse/30/7d/c6/307dc6bd4724d29d1572cc301dd7148e962604ef_2.module.ps_emailsubscriptionviewstemplateshookps_emailsubscription.tpl.php
1190 /modules/psgdpr/psgdpr.php
1191 /modules/psgdpr/translations/es.php
1192 /modules/psgdpr/classes/GDPRConsent.php
1193 /var/cache/prod/smarty/compile/warehouse/5e/ee/24/5eee242e5cbca9bb89b8ffa439cebef7beaaf2e4_2.module.psgdprviewstemplateshookdisplayGDPRConsent.tpl.php
1194 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/94/7d/69/947d69d2647da7c0eeb75ef9497030be726dc5dc_2.file.footer-copyrights-1.tpl.php
1195 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/ef/d8/5e/efd85eed67e0be9a97e7376c50dacb5344f76046_2.file.password-policy-template.tpl.php
1196 /var/cache/prod/smarty/cache/iqitcookielaw/1/1/1/6/warehouse/e7/7b/d0/e77bd029c1dc3735e3f4798f608cdf3e90a317c6.iqitcookielawviewstemplateshookiqitcookielaw.tpl.php
1197 /modules/statsdata/statsdata.php
1198 /classes/Guest.php
1199 /classes/Connection.php
1200 /classes/Page.php
1201 /classes/ConnectionsSource.php