Inicio

Utilizamos cookies propias y de terceros para mejorar nuestros servicios y mostrarle publicidad

relacionada con sus preferencias mediante el análisis de sus hábitos de navegación. Puede

consultar nuestra Política de cookies  aquí

Load Time 1429 ms
Querying Time 637 ms
Queries 827
Memory Peak Usage 25.7 Mb
Included Files 1202 files - 11.79 Mb
PrestaShop Cache - Mb
Global vars 0.25 Mb
PrestaShop Version 8.2.4
PHP Version 8.2.30
MySQL Version 10.3.39-MariaDB
Memory Limit 524M
Max Execution Time 120s
Smarty Cache enabled
Smarty Compilation never recompile
  Time Cumulated Time Memory Usage Memory Peak Usage
config 236.447 ms 236.447 ms 2.97 Mb 3.0 Mb
__construct 43.901 ms 280.348 ms - Mb 3.5 Mb
init 77.016 ms 357.364 ms 1.29 Mb 4.3 Mb
checkAccess 0.003 ms 357.367 ms - Mb 4.3 Mb
setMedia 3.734 ms 361.101 ms 0.12 Mb 4.4 Mb
postProcess 0.001 ms 361.102 ms - Mb 4.4 Mb
initHeader 0.003 ms 361.105 ms - Mb 4.4 Mb
initContent 1010 ms 1371 ms 15.82 Mb 20.3 Mb
initFooter 0.004 ms 1371 ms - Mb 20.3 Mb
display 57.858 ms 1429 ms 4.76 Mb 25.7 Mb
Hook Time Memory Usage
DisplayHeader 687.275 ms 4.98 Mb
DisplayBeforeBodyClosingTag 4.404 ms 0.30 Mb
displayFooter 3.749 ms 0.41 Mb
ProductSearchProvider 2.821 ms 0.18 Mb
displayNav1 1.860 ms 0.14 Mb
DisplayGDPRConsent 1.011 ms 0.11 Mb
DisplayFooter 0.844 ms 0.06 Mb
displayMainMenu 0.822 ms 0.17 Mb
displayBeforeBodyClosingTag 0.751 ms 0.05 Mb
ActionFrontControllerSetMedia 0.654 ms 0.01 Mb
displayNav2 0.600 ms 0.08 Mb
DisplayLeftColumn 0.333 ms 0.12 Mb
IsJustElementor 0.249 ms 0.02 Mb
ActionDispatcher 0.012 ms - Mb
displayVerticalMenu 0.009 ms - Mb
ActionProductSearchAfter 0.006 ms - Mb
Header 0.005 ms - Mb
17 hook(s) 705.405 ms 6.62 Mb
Module Time Memory Usage
iqitthemeeditor 1.475 ms 0.12 Mb
ps_emailsubscription 4.098 ms 0.42 Mb
ps_facebook 685.126 ms 4.81 Mb
ps_emailalerts 0.349 ms 0.04 Mb
productcomments 0.529 ms 0.03 Mb
ps_shoppingcart 0.172 ms 0.02 Mb
ps_accounts 1.324 ms 0.03 Mb
psxmarketingwithgoogle 2.006 ms 0.17 Mb
iqitcookielaw 1.664 ms 0.12 Mb
iqitmegamenu 5.557 ms 1.01 Mb
iqitelementor 8.023 ms 1.01 Mb
nacex 16.365 ms 2.03 Mb
ps_facetedsearch 8.855 ms 0.79 Mb
iqitlinksmanager 3.491 ms 0.30 Mb
ps_languageselector 0.581 ms 0.07 Mb
ps_currencyselector 0.496 ms 0.07 Mb
iqitsearch 0.477 ms 0.04 Mb
ps_customersignin 0.205 ms 0.04 Mb
corewhatsapp 1.384 ms 0.12 Mb
psgdpr 2.569 ms 0.32 Mb
statsdata 4.539 ms 0.32 Mb
21 module(s) 749.284 ms 11.88 Mb

Stopwatch SQL - 827 queries

# Query Time (ms) Rows Filesort Group By Location
79
SELECT SQL_NO_CACHE p.*, product_shop.*, stock.out_of_stock, IFNULL(stock.quantity, 0) AS quantity, IFNULL(product_attribute_shop.id_product_attribute, 0) AS id_product_attribute,
product_attribute_shop.minimal_quantity AS product_attribute_minimal_quantity, pl.`description`, pl.`description_short`, pl.`available_now`,
pl.`available_later`, pl.`link_rewrite`, pl.`meta_description`, pl.`meta_keywords`, pl.`meta_title`, pl.`name`, image_shop.`id_image` id_image,
il.`legend` as legend, m.`name` AS manufacturer_name, cl.`name` AS category_default,
DATEDIFF(product_shop.`date_add`, DATE_SUB("2026-04-13 00:00:00",
INTERVAL 30 DAY)) > 0 AS new, product_shop.price AS orderprice
FROM `prstshp_category_product` cp
LEFT JOIN `prstshp_product` p
ON p.`id_product` = cp.`id_product`
INNER JOIN prstshp_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1) LEFT JOIN `prstshp_product_attribute_shop` product_attribute_shop
ON (p.`id_product` = product_attribute_shop.`id_product` AND product_attribute_shop.`default_on` = 1 AND product_attribute_shop.id_shop=1)
LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `p`.id_product AND stock.id_product_attribute = 0 AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `prstshp_category_lang` cl
ON (product_shop.`id_category_default` = cl.`id_category`
AND cl.`id_lang` = 2 AND cl.id_shop = 1 )
LEFT JOIN `prstshp_product_lang` pl
ON (p.`id_product` = pl.`id_product`
AND pl.`id_lang` = 2 AND pl.id_shop = 1 )
LEFT JOIN `prstshp_image_shop` image_shop
ON (image_shop.`id_product` = p.`id_product` AND image_shop.cover=1 AND image_shop.id_shop=1)
LEFT JOIN `prstshp_image_lang` il
ON (image_shop.`id_image` = il.`id_image`
AND il.`id_lang` = 2)
LEFT JOIN `prstshp_manufacturer` m
ON m.`id_manufacturer` = p.`id_manufacturer`
WHERE product_shop.`id_shop` = 1
AND cp.`id_category` = 2 AND product_shop.`active` = 1 AND product_shop.`visibility` IN ("both", "catalog") ORDER BY cp.`position` ASC
LIMIT 432,24
96.780 ms 5250 Yes /classes/Category.php:1062
410
SELECT SQL_NO_CACHE p.id_product FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND cp.id_category IN (18, 115, 113, 15) GROUP BY p.id_product) p GROUP BY p.id_product ORDER BY p.date_add DESC, p.id_product DESC
65.524 ms 10169721 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
305
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1264
AND image_shop.`cover` = 1 LIMIT 1
26.487 ms 1 /classes/Product.php:3570
75
SELECT SQL_NO_CACHE value FROM `prstshp_configuration` WHERE `name` = "PS_MULTISHOP_FEATURE_ACTIVE" LIMIT 1
16.156 ms 1 /modules/ps_accounts/src/Adapter/Configuration.php:278
47
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 17) AND (b.`id_shop` = 1) LIMIT 1
16.007 ms 1 /src/Adapter/EntityMapper.php:71
80
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1207
AND image_shop.`cover` = 1 LIMIT 1
15.156 ms 1 /classes/Product.php:3570
74
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module` WHERE `name` = "ps_accounts" LIMIT 1
15.027 ms 1 /src/Adapter/Module/ModuleDataProvider.php:256
94
SELECT SQL_NO_CACHE h.id_hook, h.name as h_name, title, description, h.position, hm.position as hm_position, m.id_module, m.name, m.active
FROM `prstshp_hook_module` hm
STRAIGHT_JOIN `prstshp_hook` h ON (h.id_hook = hm.id_hook AND hm.id_shop = 1)
STRAIGHT_JOIN `prstshp_module` as m ON (m.id_module = hm.id_module)
ORDER BY hm.position
12.555 ms 516 /classes/Hook.php:455
739
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 4129
12.462 ms 1 /classes/Product.php:2899
5
SELECT SQL_NO_CACHE l.*, ls.`id_shop`
FROM `prstshp_lang` l
LEFT JOIN `prstshp_lang_shop` ls ON (l.id_lang = ls.id_lang)
11.403 ms 2 /classes/Language.php:1080
63
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
10.891 ms 0 /classes/module/Module.php:2137
3
SELECT SQL_NO_CACHE *
FROM `prstshp_shop` a
WHERE (a.`id_shop` = 1) LIMIT 1
10.148 ms 1 /src/Adapter/EntityMapper.php:71
21
SELECT SQL_NO_CACHE * FROM `prstshp_currency` c ORDER BY `iso_code` ASC
8.343 ms 2 Yes /classes/Currency.php:708
72
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module` WHERE `name` = "ps_facebook" LIMIT 1
6.979 ms 1 /classes/module/Module.php:2664
8
SELECT SQL_NO_CACHE *
FROM `prstshp_lang` a
LEFT JOIN `prstshp_lang_shop` `c` ON a.`id_lang` = c.`id_lang` AND c.`id_shop` = 1
WHERE (a.`id_lang` = 2) LIMIT 1
6.628 ms 1 /src/Adapter/EntityMapper.php:71
62
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module` WHERE `name` = "ps_legalcompliance" LIMIT 1
6.275 ms 0 /classes/module/Module.php:2664
582
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4127
AND image_shop.`cover` = 1 LIMIT 1
6.266 ms 1 /classes/Product.php:3570
409
SELECT SQL_NO_CACHE c.*, cl.*
FROM `prstshp_category` c
LEFT JOIN `prstshp_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 2 AND cl.id_shop = 1 )
WHERE `name` = 'JOYAS DE ORO'
AND c.`id_category` != 2
AND c.`id_parent` = 2 LIMIT 1
6.183 ms 2 /classes/Category.php:1492
10
SELECT SQL_NO_CACHE domain, domain_ssl
FROM prstshp_shop_url
WHERE main = 1
AND id_shop = 1 LIMIT 1
6.057 ms 1 /classes/shop/ShopUrl.php:178
43
SELECT SQL_NO_CACHE * FROM `prstshp_image_type` WHERE 1 AND `categories` = 1  ORDER BY `width` DESC, `height` DESC, `name`ASC
5.299 ms 8 Yes /classes/ImageType.php:109
64
SELECT SQL_NO_CACHE * FROM `prstshp_image_type` WHERE 1 AND `products` = 1  ORDER BY `width` DESC, `height` DESC, `name`ASC
5.190 ms 8 Yes /classes/ImageType.php:109
37
SELECT SQL_NO_CACHE `id_category`
FROM `prstshp_category_shop`
WHERE `id_category` = 2
AND `id_shop` = 1 LIMIT 1
4.937 ms 1 /classes/Category.php:2446
22
SELECT SQL_NO_CACHE `id_lang` FROM `prstshp_lang`
WHERE `locale` = 'es-es'
OR `language_code` = 'es-es' LIMIT 1
3.063 ms 2 /classes/Language.php:880
1
SELECT SQL_NO_CACHE gs.*, s.*, gs.name AS group_name, s.name AS shop_name, s.active, su.domain, su.domain_ssl, su.physical_uri, su.virtual_uri
FROM prstshp_shop_group gs
LEFT JOIN prstshp_shop s
ON s.id_shop_group = gs.id_shop_group
LEFT JOIN prstshp_shop_url su
ON s.id_shop = su.id_shop AND su.main = 1
WHERE s.deleted = 0
AND gs.deleted = 0
ORDER BY gs.name, s.name
2.577 ms 1 Yes /classes/shop/Shop.php:715
414
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
2.572 ms 1 /classes/Product.php:5670
2
SELECT SQL_NO_CACHE c.`name`, cl.`id_lang`, IF(cl.`id_lang` IS NULL, c.`value`, cl.`value`) AS value, c.id_shop_group, c.id_shop
FROM `prstshp_configuration` c
LEFT JOIN `prstshp_configuration_lang` cl ON (c.`id_configuration` = cl.`id_configuration`)
2.540 ms 1360 /classes/Configuration.php:180
11
SELECT SQL_NO_CACHE COUNT(DISTINCT l.id_lang) FROM `prstshp_lang` l
JOIN prstshp_lang_shop lang_shop ON (lang_shop.id_lang = l.id_lang AND lang_shop.id_shop = 1)
WHERE l.`active` = 1 LIMIT 1
2.475 ms 4 /classes/Language.php:1214
592
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4127 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4127 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
2.130 ms 0 /classes/Cart.php:1430
13
SELECT SQL_NO_CACHE h.`name` as hook, m.`id_module`, h.`id_hook`, m.`name` as module
FROM `prstshp_module` m
INNER JOIN prstshp_module_shop module_shop
ON (module_shop.id_module = m.id_module AND module_shop.id_shop = 1 AND module_shop.enable_device & 1)
INNER JOIN `prstshp_hook_module` `hm` ON hm.`id_module` = m.`id_module`
INNER JOIN `prstshp_hook` `h` ON hm.`id_hook` = h.`id_hook`
LEFT JOIN `prstshp_module_group` `mg` ON mg.`id_module` = m.`id_module`
WHERE (h.`name` != "paymentOptions") AND (hm.`id_shop` = 1) AND (mg.id_shop = 1 AND  mg.`id_group` IN (1))
GROUP BY hm.id_hook, hm.id_module
ORDER BY hm.`position`
1.893 ms 114 Yes Yes /classes/Hook.php:1289
67
SELECT SQL_NO_CACHE *
FROM `prstshp_country` a
LEFT JOIN `prstshp_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 6) LIMIT 1
1.851 ms 1 /src/Adapter/EntityMapper.php:71
93
SELECT SQL_NO_CACHE `id_hook`, `name`
FROM `prstshp_hook`
UNION
SELECT `id_hook`, ha.`alias` as name
FROM `prstshp_hook_alias` ha
INNER JOIN `prstshp_hook` h ON ha.name = h.name
1.764 ms 0 /classes/Hook.php:1348
401
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1310
ORDER BY f.position ASC
1.701 ms 1 Yes /classes/Product.php:6024
17
SELECT SQL_NO_CACHE * FROM `prstshp_hook_module_exceptions`
WHERE `id_shop` IN (1)
1.630 ms 1 /classes/module/Module.php:2046
66
SELECT SQL_NO_CACHE `need_identification_number`
FROM `prstshp_country`
WHERE `id_country` = 6 LIMIT 1
1.592 ms 1 /classes/Country.php:402
39
SELECT SQL_NO_CACHE c.*, cl.`id_lang`, cl.`name`, cl.`description`, cl.`additional_description`, cl.`link_rewrite`, cl.`meta_title`, cl.`meta_keywords`, cl.`meta_description`
FROM `prstshp_category` c
INNER JOIN prstshp_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `prstshp_category_lang` cl ON (c.`id_category` = cl.`id_category` AND `id_lang` = 2  AND cl.id_shop = 1 )
LEFT JOIN `prstshp_category_group` cg ON (cg.`id_category` = c.`id_category`)
WHERE `id_parent` = 2
AND `active` = 1
AND cg.`id_group` =1
GROUP BY c.`id_category`
ORDER BY `level_depth` ASC, category_shop.`position` ASC
1.483 ms 25 Yes Yes /classes/Category.php:916
0
SELECT SQL_NO_CACHE s.id_shop, CONCAT(su.physical_uri, su.virtual_uri) AS uri, su.domain, su.main
FROM prstshp_shop_url su
LEFT JOIN prstshp_shop s ON (s.id_shop = su.id_shop)
WHERE (su.domain = 'www.joieriaorfi.es' OR su.domain_ssl = 'www.joieriaorfi.es')
AND s.active = 1
AND s.deleted = 0
ORDER BY LENGTH(CONCAT(su.physical_uri, su.virtual_uri)) DESC
1.471 ms 1 Yes /classes/shop/Shop.php:1364
31
SELECT SQL_NO_CACHE *
FROM `prstshp_currency` a
LEFT JOIN `prstshp_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 2) LIMIT 1
1.456 ms 1 /src/Adapter/EntityMapper.php:71
19
SELECT SQL_NO_CACHE name, alias FROM `prstshp_hook_alias`
1.346 ms 88 /classes/Hook.php:342
275
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1260)
1.223 ms 1 /classes/Product.php:3860
16
SELECT SQL_NO_CACHE `id_hook`, `name` FROM `prstshp_hook`
1.216 ms 1097 /classes/Hook.php:1348
189
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1245) AND (id_product_attribute = 1802) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.212 ms 1 /classes/stock/StockAvailable.php:453
12
SELECT SQL_NO_CACHE lower(name) as name
FROM `prstshp_hook` h
WHERE (h.active = 1)
1.204 ms 1097 /classes/Hook.php:1388
7
SELECT SQL_NO_CACHE *
FROM `prstshp_shop_group` a
WHERE (a.`id_shop_group` = 1) LIMIT 1
1.202 ms 1 /src/Adapter/EntityMapper.php:71
41
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 14) AND (b.`id_shop` = 1) LIMIT 1
1.202 ms 1 /src/Adapter/EntityMapper.php:71
165
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1236
ORDER BY f.position ASC
1.082 ms 1 Yes /classes/Product.php:6024
45
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 15) AND (b.`id_shop` = 1) LIMIT 1
1.047 ms 1 /src/Adapter/EntityMapper.php:71
40
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 96) AND (b.`id_shop` = 1) LIMIT 1
1.046 ms 1 /src/Adapter/EntityMapper.php:71
299
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1263)
1.008 ms 1 /classes/Product.php:3860
411
SELECT SQL_NO_CACHE data FROM prstshp_layered_filter_block WHERE hash="4f208e25f809cf3b59011c5ba8246e51" LIMIT 1
0.986 ms 1 /modules/ps_facetedsearch/src/Filters/Block.php:185
292
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1262
ORDER BY f.position ASC
0.958 ms 1 Yes /classes/Product.php:6024
280
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1260
ORDER BY f.position ASC
0.945 ms 1 Yes /classes/Product.php:6024
287
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1262)
0.921 ms 1 /classes/Product.php:3860
153
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1235
ORDER BY f.position ASC
0.900 ms 1 Yes /classes/Product.php:6024
356
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1286) AND (b.`id_shop` = 1) LIMIT 1
0.899 ms 1 /src/Adapter/EntityMapper.php:71
48
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 18) AND (b.`id_shop` = 1) LIMIT 1
0.891 ms 1 /src/Adapter/EntityMapper.php:71
60
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 117) AND (b.`id_shop` = 1) LIMIT 1
0.885 ms 1 /src/Adapter/EntityMapper.php:71
412
SELECT SQL_NO_CACHE p.*,
ps.*,
pl.*,
sa.out_of_stock,
IFNULL(sa.quantity, 0) as quantity,
(DATEDIFF(
p.`date_add`,
DATE_SUB(
'2026-04-13 00:00:00',
INTERVAL 30 DAY
)
) > 0) as new
FROM prstshp_product p
LEFT JOIN prstshp_product_lang pl
ON pl.id_product = p.id_product
AND pl.id_shop = 1
AND pl.id_lang = 2
LEFT JOIN prstshp_stock_available sa   ON sa.id_product = p.id_product
AND sa.id_product_attribute = 0
AND sa.id_shop = 1 LEFT JOIN prstshp_product_shop ps
ON ps.id_product = p.id_product
AND ps.id_shop = 1
WHERE p.id_product IN (4149,4147,4146,4145,4144,4143,4142,4140,4139,4134,4131,4130,4129,4128,4127,4126,4125,4124,4122,4121,4120,4119,4118,4117)
0.869 ms 24 /classes/ProductAssembler.php:95
193
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `prstshp_attribute` a
LEFT JOIN `prstshp_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 2)
LEFT JOIN `prstshp_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `prstshp_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 2)
LEFT JOIN `prstshp_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 2)
WHERE pa.`id_product` = 1245
AND pac.`id_product_attribute` = 1802
AND agl.`id_lang` = 2
0.851 ms 2 /classes/Product.php:7528
389
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1289
ORDER BY f.position ASC
0.844 ms 1 Yes /classes/Product.php:6024
353
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1274
ORDER BY f.position ASC
0.833 ms 1 Yes /classes/Product.php:6024
398
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1310 AND `id_group` = 1 LIMIT 1
0.821 ms 0 /classes/GroupReduction.php:153
172
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1242)
0.816 ms 1 /classes/Product.php:3860
377
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1287
ORDER BY f.position ASC
0.813 ms 1 Yes /classes/Product.php:6024
34
SELECT SQL_NO_CACHE *
FROM `prstshp_group` a
LEFT JOIN `prstshp_group_shop` `c` ON a.`id_group` = c.`id_group` AND c.`id_shop` = 1
WHERE (a.`id_group` = 1) LIMIT 1
0.784 ms 1 /src/Adapter/EntityMapper.php:71
42
SELECT SQL_NO_CACHE state FROM prstshp_feature_flag WHERE name = 'multiple_image_format' LIMIT 1
0.784 ms 1 /classes/FeatureFlag.php:105
219
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1248)
0.780 ms 1 /classes/Product.php:3860
20
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 2) AND (b.`id_shop` = 1) LIMIT 1
0.778 ms 1 /src/Adapter/EntityMapper.php:71
245
SELECT SQL_NO_CACHE product_attribute_shop.`price`
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.`id_product_attribute` = 1807 LIMIT 1
0.770 ms 1 /classes/Combination.php:560
237
SELECT SQL_NO_CACHE pa.`available_date` FROM `prstshp_product` p LEFT JOIN `prstshp_product_attribute` pa ON (pa.`id_product` = p.`id_product`) INNER JOIN prstshp_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1) INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) WHERE p.`id_product` = 1251 AND pa.`id_product` = 1251 AND pa.`id_product_attribute` = 1806 LIMIT 1
0.767 ms 1 /classes/Product.php:1209
268
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1257
ORDER BY f.position ASC
0.766 ms 1 Yes /classes/Product.php:6024
257
SELECT SQL_NO_CACHE *
FROM `prstshp_product_attribute` a
LEFT JOIN `prstshp_product_attribute_shop` `c` ON a.`id_product_attribute` = c.`id_product_attribute` AND c.`id_shop` = 1
WHERE (a.`id_product_attribute` = 1807) LIMIT 1
0.758 ms 1 /src/Adapter/EntityMapper.php:71
148
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1235)
0.755 ms 1 /classes/Product.php:3860
383
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1289 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.746 ms 1 Yes /classes/SpecificPrice.php:576
340
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1270 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1270 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.736 ms 0 /classes/Cart.php:1430
308
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1264 LIMIT 1
0.733 ms 1 /classes/SpecificPrice.php:435
820
INSERT INTO `prstshp_guest` (`id_operating_system`, `id_web_browser`, `id_customer`, `javascript`, `screen_resolution_x`, `screen_resolution_y`, `screen_color`, `sun_java`, `adobe_flash`, `adobe_director`, `apple_quicktime`, `real_player`, `windows_media`, `accept_language`, `mobile_theme`) VALUES ('0', '0', '0', '0', '0', '0', '0', '0', '0', '0', '0', '0', '0', '', '0')
0.732 ms 1 /classes/ObjectModel.php:622
159
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1236 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.724 ms 1 Yes /classes/SpecificPrice.php:576
209
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1246
ORDER BY f.position ASC
0.722 ms 1 Yes /classes/Product.php:6024
208
SELECT SQL_NO_CACHE pa.`available_date` FROM `prstshp_product` p LEFT JOIN `prstshp_product_attribute` pa ON (pa.`id_product` = p.`id_product`) INNER JOIN prstshp_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1) INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) WHERE p.`id_product` = 1246 AND pa.`id_product` = 1246 AND pa.`id_product_attribute` = 1803 LIMIT 1
0.706 ms 1 /classes/Product.php:1209
396
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1310)
0.705 ms 1 /classes/Product.php:3860
177
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1242
ORDER BY f.position ASC
0.701 ms 1 Yes /classes/Product.php:6024
149
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1235 AND id_shop=1 LIMIT 1
0.700 ms 1 /classes/Product.php:6884
347
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1274 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.697 ms 1 Yes /classes/SpecificPrice.php:576
359
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1286 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.687 ms 1 Yes /classes/SpecificPrice.php:576
256
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `prstshp_attribute` a
LEFT JOIN `prstshp_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 2)
LEFT JOIN `prstshp_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `prstshp_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 2)
LEFT JOIN `prstshp_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 2)
WHERE pa.`id_product` = 1252
AND pac.`id_product_attribute` = 1807
AND agl.`id_lang` = 2
0.680 ms 2 /classes/Product.php:7528
239
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `prstshp_attribute` a
LEFT JOIN `prstshp_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 2)
LEFT JOIN `prstshp_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `prstshp_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 2)
LEFT JOIN `prstshp_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 2)
WHERE pa.`id_product` = 1251
AND pac.`id_product_attribute` = 1806
AND agl.`id_lang` = 2
0.675 ms 2 /classes/Product.php:7528
327
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1265 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1265 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.670 ms 0 /classes/Cart.php:1430
371
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1287 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.663 ms 1 Yes /classes/SpecificPrice.php:576
52
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 79) AND (b.`id_shop` = 1) LIMIT 1
0.660 ms 1 /src/Adapter/EntityMapper.php:71
46
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 16) AND (b.`id_shop` = 1) LIMIT 1
0.658 ms 1 /src/Adapter/EntityMapper.php:71
14
SELECT SQL_NO_CACHE `name`, `alias` FROM `prstshp_hook_alias`
0.655 ms 88 /classes/Hook.php:290
181
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1245) AND (b.`id_shop` = 1) LIMIT 1
0.650 ms 1 /src/Adapter/EntityMapper.php:71
154
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1236
AND image_shop.`cover` = 1 LIMIT 1
0.642 ms 1 /classes/Product.php:3570
169
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1242 LIMIT 1
0.641 ms 1 /classes/SpecificPrice.php:435
176
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1242 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1242 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.638 ms 0 /classes/Cart.php:1430
251
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1252 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1252 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.630 ms 0 /classes/Cart.php:1430
235
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1251) AND (id_product_attribute = 1806) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.622 ms 1 /classes/stock/StockAvailable.php:453
262
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1257 LIMIT 1
0.617 ms 1 /classes/SpecificPrice.php:435
366
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1287
AND image_shop.`cover` = 1 LIMIT 1
0.617 ms 1 /classes/Product.php:3570
253
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 1807
AND cp.`id_cart` = 0 AND cp.`id_product` = 1252 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 1807
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1252 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.613 ms 0 /classes/Cart.php:1430
160
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1236)
0.613 ms 1 /classes/Product.php:3860
380
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1289) AND (b.`id_shop` = 1) LIMIT 1
0.612 ms 1 /src/Adapter/EntityMapper.php:71
240
SELECT SQL_NO_CACHE *
FROM `prstshp_product_attribute` a
LEFT JOIN `prstshp_product_attribute_shop` `c` ON a.`id_product_attribute` = c.`id_product_attribute` AND c.`id_shop` = 1
WHERE (a.`id_product_attribute` = 1806) LIMIT 1
0.610 ms 1 /src/Adapter/EntityMapper.php:71
225
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1251
AND image_shop.`cover` = 1 LIMIT 1
0.607 ms 2 /classes/Product.php:3570
231
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1251 AND id_shop=1 LIMIT 1
0.605 ms 1 /classes/Product.php:6884
392
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1310) AND (b.`id_shop` = 1) LIMIT 1
0.604 ms 1 /src/Adapter/EntityMapper.php:71
295
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1263) AND (b.`id_shop` = 1) LIMIT 1
0.603 ms 1 /src/Adapter/EntityMapper.php:71
25
SELECT SQL_NO_CACHE *
FROM `prstshp_currency` a
LEFT JOIN `prstshp_currency_lang` `b` ON a.`id_currency` = b.`id_currency` AND b.`id_lang` = 2
LEFT JOIN `prstshp_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 2) LIMIT 1
0.601 ms 1 /src/Adapter/EntityMapper.php:71
368
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1287) AND (b.`id_shop` = 1) LIMIT 1
0.598 ms 1 /src/Adapter/EntityMapper.php:71
342
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1274
AND image_shop.`cover` = 1 LIMIT 1
0.598 ms 1 /classes/Product.php:3570
6
SELECT SQL_NO_CACHE *
FROM `prstshp_country` a
LEFT JOIN `prstshp_country_lang` `b` ON a.`id_country` = b.`id_country` AND b.`id_lang` = 2
LEFT JOIN `prstshp_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 6) LIMIT 1
0.589 ms 1 /src/Adapter/EntityMapper.php:71
83
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1207) AND (b.`id_shop` = 1) LIMIT 1
0.584 ms 1 /src/Adapter/EntityMapper.php:71
156
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1236) AND (b.`id_shop` = 1) LIMIT 1
0.582 ms 1 /src/Adapter/EntityMapper.php:71
365
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1286
ORDER BY f.position ASC
0.579 ms 1 Yes /classes/Product.php:6024
58
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 113) AND (b.`id_shop` = 1) LIMIT 1
0.563 ms 1 /src/Adapter/EntityMapper.php:71
316
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1264
ORDER BY f.position ASC
0.561 ms 1 Yes /classes/Product.php:6024
53
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 86) AND (b.`id_shop` = 1) LIMIT 1
0.559 ms 1 /src/Adapter/EntityMapper.php:71
252
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1252) AND (id_product_attribute = 1807) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.559 ms 1 /classes/stock/StockAvailable.php:453
387
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1289) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.548 ms 1 /classes/stock/StockAvailable.php:453
224
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1248
ORDER BY f.position ASC
0.545 ms 1 Yes /classes/Product.php:6024
591
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 4127) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.543 ms 1 /classes/stock/StockAvailable.php:453
184
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1245)
0.538 ms 1 /classes/Product.php:3860
304
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1263
ORDER BY f.position ASC
0.536 ms 1 Yes /classes/Product.php:6024
4
SELECT SQL_NO_CACHE su.physical_uri, su.virtual_uri, su.domain, su.domain_ssl
FROM prstshp_shop s
LEFT JOIN prstshp_shop_url su ON (s.id_shop = su.id_shop)
WHERE s.id_shop = 1
AND s.active = 1 AND s.deleted = 0 AND su.main = 1 LIMIT 1
0.533 ms 1 /classes/shop/Shop.php:214
328
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1265
ORDER BY f.position ASC
0.530 ms 1 Yes /classes/Product.php:6024
269
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1260
AND image_shop.`cover` = 1 LIMIT 1
0.527 ms 1 /classes/Product.php:3570
580
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4128 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4128 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.526 ms 0 /classes/Cart.php:1430
200
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1246 LIMIT 1
0.524 ms 1 /classes/SpecificPrice.php:435
261
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1257) AND (b.`id_shop` = 1) LIMIT 1
0.522 ms 1 /src/Adapter/EntityMapper.php:71
55
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 93) AND (b.`id_shop` = 1) LIMIT 1
0.520 ms 1 /src/Adapter/EntityMapper.php:71
164
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1236 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1236 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.514 ms 0 /classes/Cart.php:1430
147
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1235 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.514 ms 1 Yes /classes/SpecificPrice.php:576
345
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1274 LIMIT 1
0.513 ms 1 /classes/SpecificPrice.php:435
68
SELECT SQL_NO_CACHE *
FROM `prstshp_country_lang`
WHERE `id_country` = 6
0.511 ms 2 /src/Adapter/EntityMapper.php:79
201
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1246)
0.508 ms 1 /classes/Product.php:3860
212
SELECT SQL_NO_CACHE *
FROM `prstshp_product_attribute_lang`
WHERE `id_product_attribute` = 1803
0.506 ms 2 /src/Adapter/EntityMapper.php:79
824
INSERT INTO `prstshp_connections` (`id_guest`, `id_page`, `ip_address`, `http_referer`, `id_shop`, `id_shop_group`, `date_add`) VALUES ('16684190', '118', '3628718218', '', '1', '1', '2026-04-13 11:46:10')
0.502 ms 1 /classes/ObjectModel.php:622
191
SELECT SQL_NO_CACHE pa.`available_date` FROM `prstshp_product` p LEFT JOIN `prstshp_product_attribute` pa ON (pa.`id_product` = p.`id_product`) INNER JOIN prstshp_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1) INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) WHERE p.`id_product` = 1245 AND pa.`id_product` = 1245 AND pa.`id_product_attribute` = 1802 LIMIT 1
0.500 ms 1 /classes/Product.php:1209
195
SELECT SQL_NO_CACHE *
FROM `prstshp_product_attribute_lang`
WHERE `id_product_attribute` = 1802
0.491 ms 2 /src/Adapter/EntityMapper.php:79
520
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4139 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4139 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.491 ms 0 /classes/Cart.php:1430
479
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 4143 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.490 ms 1 Yes /classes/SpecificPrice.php:576
311
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1264)
0.485 ms 1 /classes/Product.php:3860
683
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 4118 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.483 ms 1 Yes /classes/SpecificPrice.php:576
318
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.481 ms 1 /classes/Product.php:5670
270
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.479 ms 1 /classes/Product.php:5670
178
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1245
AND image_shop.`cover` = 1 LIMIT 1
0.477 ms 1 /classes/Product.php:3570
312
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1264 AND id_shop=1 LIMIT 1
0.477 ms 1 /classes/Product.php:6884
795
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4140) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.475 ms 1 Yes /classes/Product.php:4513
50
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 59) AND (b.`id_shop` = 1) LIMIT 1
0.472 ms 1 /src/Adapter/EntityMapper.php:71
243
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 15 LIMIT 1
0.472 ms 1 /classes/Product.php:5670
544
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4131 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4131 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.472 ms 0 /classes/Cart.php:1430
587
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 4127 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.472 ms 1 Yes /classes/SpecificPrice.php:576
213
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1248
AND image_shop.`cover` = 1 LIMIT 1
0.469 ms 2 /classes/Product.php:3570
484
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4143 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4143 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.468 ms 0 /classes/Cart.php:1430
317
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1265
AND image_shop.`cover` = 1 LIMIT 1
0.467 ms 1 /classes/Product.php:3570
455
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 4145 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.466 ms 1 Yes /classes/SpecificPrice.php:576
267
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1257 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1257 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.464 ms 0 /classes/Cart.php:1430
331
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 17 LIMIT 1
0.464 ms 1 /classes/Product.php:5670
788
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4149) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.464 ms 1 Yes /classes/Product.php:4513
89
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1207
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.461 ms 0 /classes/SpecificPrice.php:256
306
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.461 ms 1 /classes/Product.php:5670
539
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 4131 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.460 ms 1 Yes /classes/SpecificPrice.php:576
194
SELECT SQL_NO_CACHE *
FROM `prstshp_product_attribute` a
LEFT JOIN `prstshp_product_attribute_shop` `c` ON a.`id_product_attribute` = c.`id_product_attribute` AND c.`id_shop` = 1
WHERE (a.`id_product_attribute` = 1802) LIMIT 1
0.460 ms 1 /src/Adapter/EntityMapper.php:71
282
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.460 ms 1 /classes/Product.php:5670
532
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4134 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4134 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.459 ms 0 /classes/Cart.php:1430
352
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1274 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1274 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.457 ms 0 /classes/Cart.php:1430
161
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1236 AND id_shop=1 LIMIT 1
0.455 ms 1 /classes/Product.php:6884
198
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1246) AND (b.`id_shop` = 1) LIMIT 1
0.455 ms 1 /src/Adapter/EntityMapper.php:71
334
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1270
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.454 ms 0 /classes/SpecificPrice.php:256
228
SELECT SQL_NO_CACHE product_attribute_shop.`price`
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.`id_product_attribute` = 1806 LIMIT 1
0.453 ms 1 /classes/Combination.php:560
472
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4144 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4144 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.453 ms 0 /classes/Cart.php:1430
551
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 4130 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.451 ms 1 Yes /classes/SpecificPrice.php:576
216
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1248 LIMIT 1
0.450 ms 1 /classes/SpecificPrice.php:435
467
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 4144 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.450 ms 1 Yes /classes/SpecificPrice.php:576
234
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1251 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1251 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.448 ms 0 /classes/Cart.php:1430
206
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1246) AND (id_product_attribute = 1803) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.445 ms 1 /classes/stock/StockAvailable.php:453
652
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4121 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4121 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.444 ms 0 /classes/Cart.php:1430
556
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4130 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4130 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.443 ms 0 /classes/Cart.php:1430
599
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 4126 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.443 ms 1 Yes /classes/SpecificPrice.php:576
647
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 4121 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.443 ms 1 Yes /classes/SpecificPrice.php:576
503
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 4140 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.442 ms 1 Yes /classes/SpecificPrice.php:576
527
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 4134 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.442 ms 1 Yes /classes/SpecificPrice.php:576
204
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1246) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.439 ms 1 /classes/stock/StockAvailable.php:453
321
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1265
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.437 ms 0 /classes/SpecificPrice.php:256
404
SELECT SQL_NO_CACHE `id_category`
FROM `prstshp_category_shop`
WHERE `id_category` = 2
AND `id_shop` = 1 LIMIT 1
0.437 ms 1 /classes/Category.php:2446
15
SELECT SQL_NO_CACHE m.page, ml.url_rewrite, ml.id_lang
FROM `prstshp_meta` m
LEFT JOIN `prstshp_meta_lang` ml ON (m.id_meta = ml.id_meta AND ml.id_shop = 1 )
ORDER BY LENGTH(ml.url_rewrite) DESC
0.435 ms 56 Yes /classes/Dispatcher.php:654
635
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 4122 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.433 ms 1 Yes /classes/SpecificPrice.php:576
71
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a0
LEFT JOIN `prstshp_category_lang` `a1` ON (a0.`id_category` = a1.`id_category`)
WHERE (a0.`nleft` < 2) AND (a0.`nright` > 197) AND (a1.`id_lang` = 2) AND (a1.`id_shop` = 1)
ORDER BY a0.`nleft` asc
0.432 ms 1 /classes/PrestaShopCollection.php:383
695
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 4117 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.432 ms 1 Yes /classes/SpecificPrice.php:576
344
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1274) AND (b.`id_shop` = 1) LIMIT 1
0.431 ms 1 /src/Adapter/EntityMapper.php:71
628
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4124 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4124 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.431 ms 0 /classes/Cart.php:1430
221
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1248 AND `id_group` = 1 LIMIT 1
0.430 ms 0 /classes/GroupReduction.php:153
376
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1287 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1287 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.430 ms 0 /classes/Cart.php:1430
491
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 4142 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.428 ms 1 Yes /classes/SpecificPrice.php:576
211
SELECT SQL_NO_CACHE *
FROM `prstshp_product_attribute` a
LEFT JOIN `prstshp_product_attribute_shop` `c` ON a.`id_product_attribute` = c.`id_product_attribute` AND c.`id_shop` = 1
WHERE (a.`id_product_attribute` = 1803) LIMIT 1
0.428 ms 1 /src/Adapter/EntityMapper.php:71
313
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1264 AND `id_group` = 1 LIMIT 1
0.428 ms 0 /classes/GroupReduction.php:153
611
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 4125 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.427 ms 1 Yes /classes/SpecificPrice.php:576
302
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1263) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.426 ms 1 /classes/stock/StockAvailable.php:453
659
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 4120 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.424 ms 1 Yes /classes/SpecificPrice.php:576
388
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1289 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1289 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.423 ms 0 /classes/Cart.php:1430
640
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4122 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4122 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.423 ms 0 /classes/Cart.php:1430
286
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1262 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.417 ms 1 Yes /classes/SpecificPrice.php:576
616
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4125 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4125 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.417 ms 0 /classes/Cart.php:1430
395
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1310 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.416 ms 1 Yes /classes/SpecificPrice.php:576
623
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 4124 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.415 ms 1 Yes /classes/SpecificPrice.php:576
168
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1242) AND (b.`id_shop` = 1) LIMIT 1
0.414 ms 1 /src/Adapter/EntityMapper.php:71
604
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4126 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4126 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.414 ms 0 /classes/Cart.php:1430
226
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 15 LIMIT 1
0.413 ms 1 /classes/Product.php:5670
671
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 4119 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.412 ms 1 Yes /classes/SpecificPrice.php:576
789
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4147) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.412 ms 1 Yes /classes/Product.php:4513
664
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4120 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4120 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.410 ms 0 /classes/Cart.php:1430
700
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4117 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4117 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.408 ms 0 /classes/Cart.php:1430
255
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1252
ORDER BY f.position ASC
0.408 ms 1 Yes /classes/Product.php:6024
274
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1260 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.408 ms 1 Yes /classes/SpecificPrice.php:576
676
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4119 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4119 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.406 ms 0 /classes/Cart.php:1430
391
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.405 ms 1 /classes/Product.php:5670
620
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4124) AND (b.`id_shop` = 1) LIMIT 1
0.404 ms 1 /src/Adapter/EntityMapper.php:71
281
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1262
AND image_shop.`cover` = 1 LIMIT 1
0.404 ms 1 /classes/Product.php:3570
790
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4146) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.403 ms 1 Yes /classes/Product.php:4513
289
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1262 AND `id_group` = 1 LIMIT 1
0.402 ms 0 /classes/GroupReduction.php:153
399
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1310) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.402 ms 1 /classes/stock/StockAvailable.php:453
496
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4142 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4142 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.400 ms 0 /classes/Cart.php:1430
192
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1245
ORDER BY f.position ASC
0.399 ms 1 Yes /classes/Product.php:6024
264
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1257 AND id_shop=1 LIMIT 1
0.397 ms 1 /classes/Product.php:6884
460
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4145 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4145 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.396 ms 0 /classes/Cart.php:1430
515
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 4139 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.396 ms 1 Yes /classes/SpecificPrice.php:576
584
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4127) AND (b.`id_shop` = 1) LIMIT 1
0.396 ms 1 /src/Adapter/EntityMapper.php:71
688
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4118 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4118 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.396 ms 0 /classes/Cart.php:1430
171
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1242 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.395 ms 1 Yes /classes/SpecificPrice.php:576
825
INSERT INTO `prstshp_connections_source` (`id_connections`, `http_referer`, `request_uri`, `keywords`, `date_add`) VALUES ('15469676', '', 'www.joieriaorfi.es/2-inicio?page=19&q=Categor%C3%ADas-JOYAS+DE+PLATA-LATON-PENJOLL-JOYAS+DE+ORO', '', '2026-04-13 11:46:10')
0.395 ms 1 /classes/ObjectModel.php:622
167
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 14 LIMIT 1
0.394 ms 1 /classes/Product.php:5670
449
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4146
ORDER BY f.position ASC
0.394 ms 1 Yes /classes/Product.php:6024
375
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1287) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.393 ms 1 /classes/stock/StockAvailable.php:453
244
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1252) AND (b.`id_shop` = 1) LIMIT 1
0.391 ms 1 /src/Adapter/EntityMapper.php:71
277
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1260 AND `id_group` = 1 LIMIT 1
0.390 ms 0 /classes/GroupReduction.php:153
405
SELECT SQL_NO_CACHE type, id_value, filter_show_limit, filter_type FROM prstshp_layered_category
WHERE controller = 'category'
AND id_category = 2
AND id_shop = 1
GROUP BY `type`, id_value ORDER BY position ASC
0.389 ms 2 Yes Yes /modules/ps_facetedsearch/src/Filters/Provider.php:57
320
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1265 LIMIT 1
0.383 ms 1 /classes/SpecificPrice.php:435
792
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4144) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.382 ms 1 Yes /classes/Product.php:4513
18
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `prstshp_module` m
LEFT JOIN `prstshp_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
0.380 ms 102 /classes/module/Module.php:341
139
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1224 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1224 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.379 ms 0 /classes/Cart.php:1430
548
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4130) AND (b.`id_shop` = 1) LIMIT 1
0.377 ms 1 /src/Adapter/EntityMapper.php:71
791
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4145) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.375 ms 1 Yes /classes/Product.php:4513
793
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4143) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.371 ms 1 Yes /classes/Product.php:4513
508
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4140 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4140 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.371 ms 0 /classes/Cart.php:1430
406
SELECT SQL_NO_CACHE c.*, cl.*
FROM `prstshp_category` c
LEFT JOIN `prstshp_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 2 AND cl.id_shop = 1 )
WHERE `name` = 'JOYAS DE PLATA'
AND c.`id_category` != 2
AND c.`id_parent` = 2 LIMIT 1
0.370 ms 2 /classes/Category.php:1492
424
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4149 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4149 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.369 ms 0 /classes/Cart.php:1430
338
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1270 AND `id_group` = 1 LIMIT 1
0.369 ms 0 /classes/GroupReduction.php:153
102
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1207 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1207 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.367 ms 0 /classes/Cart.php:1430
361
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1286 AND id_shop=1 LIMIT 1
0.367 ms 1 /classes/Product.php:6884
333
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1270 LIMIT 1
0.367 ms 1 /classes/SpecificPrice.php:435
362
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1286 AND `id_group` = 1 LIMIT 1
0.366 ms 0 /classes/GroupReduction.php:153
476
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4143) AND (b.`id_shop` = 1) LIMIT 1
0.366 ms 1 /src/Adapter/EntityMapper.php:71
524
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4134) AND (b.`id_shop` = 1) LIMIT 1
0.366 ms 1 /src/Adapter/EntityMapper.php:71
323
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1265)
0.365 ms 1 /classes/Product.php:3860
419
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 4149 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.365 ms 1 Yes /classes/SpecificPrice.php:576
238
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1251
ORDER BY f.position ASC
0.364 ms 1 Yes /classes/Product.php:6024
336
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1270)
0.364 ms 1 /classes/Product.php:3860
799
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4130) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.364 ms 1 Yes /classes/Product.php:4513
91
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1207)
0.364 ms 1 /classes/Product.php:3860
351
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1274) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.364 ms 1 /classes/stock/StockAvailable.php:453
59
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 115) AND (b.`id_shop` = 1) LIMIT 1
0.362 ms 1 /src/Adapter/EntityMapper.php:71
796
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4139) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.359 ms 1 Yes /classes/Product.php:4513
452
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4145) AND (b.`id_shop` = 1) LIMIT 1
0.358 ms 1 /src/Adapter/EntityMapper.php:71
9
SELECT SQL_NO_CACHE id_shop
FROM `prstshp_lang_shop`
WHERE `id_lang` = 2
AND id_shop = 1 LIMIT 1
0.357 ms 1 /classes/ObjectModel.php:1727
596
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4126) AND (b.`id_shop` = 1) LIMIT 1
0.356 ms 1 /src/Adapter/EntityMapper.php:71
230
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1251)
0.354 ms 1 /classes/Product.php:3860
560
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4129) AND (b.`id_shop` = 1) LIMIT 1
0.353 ms 1 /src/Adapter/EntityMapper.php:71
810
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4118) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.352 ms 1 Yes /classes/Product.php:4513
110
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1216 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.352 ms 1 Yes /classes/SpecificPrice.php:576
480
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4143)
0.352 ms 1 /classes/Product.php:3860
485
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4143
ORDER BY f.position ASC
0.352 ms 1 Yes /classes/Product.php:6024
65
SELECT SQL_NO_CACHE format
FROM `prstshp_address_format`
WHERE `id_country` = 6 LIMIT 1
0.351 ms 1 /classes/AddressFormat.php:653
608
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4125) AND (b.`id_shop` = 1) LIMIT 1
0.351 ms 1 /src/Adapter/EntityMapper.php:71
103
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1207
ORDER BY f.position ASC
0.348 ms 1 Yes /classes/Product.php:6024
363
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1286) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.348 ms 1 /classes/stock/StockAvailable.php:453
536
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4131) AND (b.`id_shop` = 1) LIMIT 1
0.348 ms 1 /src/Adapter/EntityMapper.php:71
802
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4127) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.348 ms 1 Yes /classes/Product.php:4513
807
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4121) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.347 ms 1 Yes /classes/Product.php:4513
259
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1257
AND image_shop.`cover` = 1 LIMIT 1
0.347 ms 1 /classes/Product.php:3570
325
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1265 AND `id_group` = 1 LIMIT 1
0.347 ms 0 /classes/GroupReduction.php:153
617
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4125
ORDER BY f.position ASC
0.346 ms 1 Yes /classes/Product.php:6024
632
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4122) AND (b.`id_shop` = 1) LIMIT 1
0.345 ms 1 /src/Adapter/EntityMapper.php:71
680
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4118) AND (b.`id_shop` = 1) LIMIT 1
0.345 ms 1 /src/Adapter/EntityMapper.php:71
804
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4125) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.344 ms 1 Yes /classes/Product.php:4513
805
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4124) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.344 ms 1 Yes /classes/Product.php:4513
346
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1274
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.343 ms 1 /classes/SpecificPrice.php:256
500
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4140) AND (b.`id_shop` = 1) LIMIT 1
0.342 ms 1 /src/Adapter/EntityMapper.php:71
343
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 14 LIMIT 1
0.342 ms 1 /classes/Product.php:5670
794
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4142) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.342 ms 1 Yes /classes/Product.php:4513
122
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1222 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.341 ms 1 Yes /classes/SpecificPrice.php:576
563
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 4129 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.341 ms 1 Yes /classes/SpecificPrice.php:576
653
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4121
ORDER BY f.position ASC
0.340 ms 1 Yes /classes/Product.php:6024
218
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1248 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.339 ms 1 Yes /classes/SpecificPrice.php:576
809
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4119) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.339 ms 1 Yes /classes/Product.php:4513
284
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1262 LIMIT 1
0.339 ms 1 /classes/SpecificPrice.php:435
488
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4142) AND (b.`id_shop` = 1) LIMIT 1
0.338 ms 1 /src/Adapter/EntityMapper.php:71
521
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4139
ORDER BY f.position ASC
0.338 ms 1 Yes /classes/Product.php:6024
801
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4128) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.338 ms 1 Yes /classes/Product.php:4513
798
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4131) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.336 ms 1 Yes /classes/Product.php:4513
797
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4134) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.336 ms 1 Yes /classes/Product.php:4513
56
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 112) AND (b.`id_shop` = 1) LIMIT 1
0.335 ms 1 /src/Adapter/EntityMapper.php:71
593
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4127
ORDER BY f.position ASC
0.335 ms 1 Yes /classes/Product.php:6024
173
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1242 AND id_shop=1 LIMIT 1
0.334 ms 1 /classes/Product.php:6884
220
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1248 AND id_shop=1 LIMIT 1
0.334 ms 1 /classes/Product.php:6884
806
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4122) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.334 ms 1 Yes /classes/Product.php:4513
811
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4117) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.334 ms 1 Yes /classes/Product.php:4513
800
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4129) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.334 ms 1 Yes /classes/Product.php:4513
533
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4134
ORDER BY f.position ASC
0.331 ms 1 Yes /classes/Product.php:6024
329
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1270
AND image_shop.`cover` = 1 LIMIT 1
0.330 ms 1 /classes/Product.php:3570
803
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4126) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.330 ms 1 Yes /classes/Product.php:4513
656
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4120) AND (b.`id_shop` = 1) LIMIT 1
0.328 ms 1 /src/Adapter/EntityMapper.php:71
605
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4126
ORDER BY f.position ASC
0.327 ms 1 Yes /classes/Product.php:6024
735
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 4130
ORDER BY `position`
0.327 ms 1 Yes /classes/Product.php:3539
461
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4145
ORDER BY f.position ASC
0.327 ms 1 Yes /classes/Product.php:6024
692
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4117) AND (b.`id_shop` = 1) LIMIT 1
0.326 ms 1 /src/Adapter/EntityMapper.php:71
808
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4120) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.326 ms 1 Yes /classes/Product.php:4513
272
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1260 LIMIT 1
0.325 ms 1 /classes/SpecificPrice.php:435
254
SELECT SQL_NO_CACHE pa.`available_date` FROM `prstshp_product` p LEFT JOIN `prstshp_product_attribute` pa ON (pa.`id_product` = p.`id_product`) INNER JOIN prstshp_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1) INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) WHERE p.`id_product` = 1252 AND pa.`id_product` = 1252 AND pa.`id_product_attribute` = 1807 LIMIT 1
0.325 ms 1 /classes/Product.php:1209
78
SELECT SQL_NO_CACHE *
FROM `prstshp_configuration_lang`
WHERE `id_configuration` = 1315
0.324 ms 1 /src/Adapter/EntityMapper.php:79
431
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 4147 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.324 ms 1 Yes /classes/SpecificPrice.php:576
473
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4144
ORDER BY f.position ASC
0.324 ms 1 Yes /classes/Product.php:6024
448
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4146 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4146 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.323 ms 0 /classes/Cart.php:1430
512
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4139) AND (b.`id_shop` = 1) LIMIT 1
0.322 ms 1 /src/Adapter/EntityMapper.php:71
668
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4119) AND (b.`id_shop` = 1) LIMIT 1
0.322 ms 1 /src/Adapter/EntityMapper.php:71
152
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1235 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1235 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.322 ms 0 /classes/Cart.php:1430
568
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4129 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4129 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.322 ms 0 /classes/Cart.php:1430
644
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4121) AND (b.`id_shop` = 1) LIMIT 1
0.321 ms 1 /src/Adapter/EntityMapper.php:71
689
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4118
ORDER BY f.position ASC
0.320 ms 1 Yes /classes/Product.php:6024
740
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (4909) AND il.`id_lang` = 2 ORDER by i.`position`
0.320 ms 1 Yes /classes/Product.php:2915
146
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1235
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.319 ms 1 /classes/SpecificPrice.php:256
545
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4131
ORDER BY f.position ASC
0.319 ms 1 Yes /classes/Product.php:6024
575
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 4128 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.318 ms 1 Yes /classes/SpecificPrice.php:576
400
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1310 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1310 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.317 ms 0 /classes/Cart.php:1430
581
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4128
ORDER BY f.position ASC
0.317 ms 1 Yes /classes/Product.php:6024
115
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1216 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1216 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.314 ms 0 /classes/Cart.php:1430
310
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1264 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.313 ms 1 Yes /classes/SpecificPrice.php:576
629
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4124
ORDER BY f.position ASC
0.313 ms 1 Yes /classes/Product.php:6024
378
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1289
AND image_shop.`cover` = 1 LIMIT 1
0.311 ms 1 /classes/Product.php:3570
28
SELECT SQL_NO_CACHE c.id_currency
FROM `prstshp_currency` c
WHERE (iso_code = 'USD') LIMIT 1
0.311 ms 1 /classes/Currency.php:893
127
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1222 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1222 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.311 ms 0 /classes/Cart.php:1430
187
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1245) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.311 ms 1 /classes/stock/StockAvailable.php:453
557
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4130
ORDER BY f.position ASC
0.310 ms 1 Yes /classes/Product.php:6024
134
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1224 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.309 ms 1 Yes /classes/SpecificPrice.php:576
293
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1263
AND image_shop.`cover` = 1 LIMIT 1
0.309 ms 1 /classes/Product.php:3570
298
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1263 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.309 ms 1 Yes /classes/SpecificPrice.php:576
464
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4144) AND (b.`id_shop` = 1) LIMIT 1
0.309 ms 1 /src/Adapter/EntityMapper.php:71
36
SELECT SQL_NO_CACHE id_shop
FROM `prstshp_group_shop`
WHERE `id_group` = 1
AND id_shop = 1 LIMIT 1
0.307 ms 1 /classes/ObjectModel.php:1727
497
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4142
ORDER BY f.position ASC
0.307 ms 1 Yes /classes/Product.php:6024
509
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4140
ORDER BY f.position ASC
0.307 ms 1 Yes /classes/Product.php:6024
641
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4122
ORDER BY f.position ASC
0.307 ms 1 Yes /classes/Product.php:6024
665
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4120
ORDER BY f.position ASC
0.304 ms 1 Yes /classes/Product.php:6024
322
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1265 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.304 ms 1 Yes /classes/SpecificPrice.php:576
436
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4147 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4147 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.304 ms 0 /classes/Cart.php:1430
354
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1286
AND image_shop.`cover` = 1 LIMIT 1
0.302 ms 1 /classes/Product.php:3570
188
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1245 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1245 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.300 ms 0 /classes/Cart.php:1430
492
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4142)
0.300 ms 1 /classes/Product.php:3860
677
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4119
ORDER BY f.position ASC
0.299 ms 1 Yes /classes/Product.php:6024
701
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4117
ORDER BY f.position ASC
0.299 ms 1 Yes /classes/Product.php:6024
364
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1286 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1286 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.298 ms 0 /classes/Cart.php:1430
86
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE `id_product` != 0 LIMIT 1
0.295 ms 1808 /classes/SpecificPrice.php:297
242
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1252
AND image_shop.`cover` = 1 LIMIT 1
0.294 ms 2 /classes/Product.php:3570
77
SELECT SQL_NO_CACHE *
FROM `prstshp_configuration` a
WHERE (a.`id_configuration` = 1315) LIMIT 1
0.294 ms 1 /src/Adapter/EntityMapper.php:71
279
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1260 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1260 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.294 ms 0 /classes/Cart.php:1430
741
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 4128
ORDER BY `position`
0.294 ms 1 Yes /classes/Product.php:3539
57
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 122) AND (b.`id_shop` = 1) LIMIT 1
0.293 ms 1 /src/Adapter/EntityMapper.php:71
303
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1263 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1263 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.293 ms 0 /classes/Cart.php:1430
236
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 1806
AND cp.`id_cart` = 0 AND cp.`id_product` = 1251 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 1806
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1251 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.292 ms 0 /classes/Cart.php:1430
443
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 4146 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.292 ms 1 Yes /classes/SpecificPrice.php:576
223
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1248 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1248 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.292 ms 0 /classes/Cart.php:1430
90
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1207 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.291 ms 1 Yes /classes/SpecificPrice.php:576
403
SELECT SQL_NO_CACHE `name`
FROM `prstshp_hook`
WHERE `id_hook` = 746 LIMIT 1
0.291 ms 1 /classes/Hook.php:244
248
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1252 AND id_shop=1 LIMIT 1
0.289 ms 1 /classes/Product.php:6884
157
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1236 LIMIT 1
0.288 ms 1 /classes/SpecificPrice.php:435
190
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 1802
AND cp.`id_cart` = 0 AND cp.`id_product` = 1245 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 1802
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1245 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.288 ms 0 /classes/Cart.php:1430
335
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1270 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.288 ms 1 Yes /classes/SpecificPrice.php:576
385
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1289 AND id_shop=1 LIMIT 1
0.287 ms 1 /classes/Product.php:6884
131
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1224) AND (b.`id_shop` = 1) LIMIT 1
0.286 ms 1 /src/Adapter/EntityMapper.php:71
624
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4124)
0.286 ms 1 /classes/Product.php:3860
51
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 68) AND (b.`id_shop` = 1) LIMIT 1
0.285 ms 1 /src/Adapter/EntityMapper.php:71
291
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1262 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1262 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.285 ms 0 /classes/Cart.php:1430
107
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1216) AND (b.`id_shop` = 1) LIMIT 1
0.285 ms 1 /src/Adapter/EntityMapper.php:71
297
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1263
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.284 ms 0 /classes/SpecificPrice.php:256
381
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1289 LIMIT 1
0.284 ms 1 /classes/SpecificPrice.php:435
207
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 1803
AND cp.`id_cart` = 0 AND cp.`id_product` = 1246 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 1803
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1246 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.283 ms 0 /classes/Cart.php:1430
315
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1264 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1264 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.283 ms 0 /classes/Cart.php:1430
210
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `prstshp_attribute` a
LEFT JOIN `prstshp_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 2)
LEFT JOIN `prstshp_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `prstshp_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 2)
LEFT JOIN `prstshp_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 2)
WHERE pa.`id_product` = 1246
AND pac.`id_product_attribute` = 1803
AND agl.`id_lang` = 2
0.281 ms 2 /classes/Product.php:7528
205
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1246 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1246 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.280 ms 0 /classes/Cart.php:1430
217
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1248
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.280 ms 1 /classes/SpecificPrice.php:256
85
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1207 LIMIT 1
0.278 ms 1 /classes/SpecificPrice.php:435
720
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 4142
ORDER BY `position`
0.276 ms 1 Yes /classes/Product.php:3539
407
SELECT SQL_NO_CACHE c.*, cl.*
FROM `prstshp_category` c
LEFT JOIN `prstshp_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 2 AND cl.id_shop = 1 )
WHERE `name` = 'LATON'
AND c.`id_category` != 2
AND c.`id_parent` = 2 LIMIT 1
0.275 ms 3 /classes/Category.php:1492
588
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4127)
0.274 ms 1 /classes/Product.php:3860
408
SELECT SQL_NO_CACHE c.*, cl.*
FROM `prstshp_category` c
LEFT JOIN `prstshp_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 2 AND cl.id_shop = 1 )
WHERE `name` = 'PENJOLL'
AND c.`id_category` != 2
AND c.`id_parent` = 2 LIMIT 1
0.274 ms 3 /classes/Category.php:1492
684
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4118)
0.274 ms 1 /classes/Product.php:3860
765
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 4119
ORDER BY `position`
0.272 ms 1 Yes /classes/Product.php:3539
572
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4128) AND (b.`id_shop` = 1) LIMIT 1
0.271 ms 1 /src/Adapter/EntityMapper.php:71
753
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 4124
ORDER BY `position`
0.271 ms 1 Yes /classes/Product.php:3539
747
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 4126
ORDER BY `position`
0.268 ms 1 Yes /classes/Product.php:3539
771
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 4117
ORDER BY `position`
0.268 ms 1 Yes /classes/Product.php:3539
357
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1286 LIMIT 1
0.267 ms 1 /classes/SpecificPrice.php:435
471
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 4144) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.267 ms 1 /classes/stock/StockAvailable.php:453
705
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 4147
ORDER BY `position`
0.265 ms 1 Yes /classes/Product.php:3539
349
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1274 AND id_shop=1 LIMIT 1
0.265 ms 1 /classes/Product.php:6884
393
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1310 LIMIT 1
0.265 ms 1 /classes/SpecificPrice.php:435
456
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4145)
0.265 ms 1 /classes/Product.php:3860
104
SELECT SQL_NO_CACHE tr.*
FROM `prstshp_tax_rule` tr
JOIN `prstshp_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 6
AND tr.`id_tax_rules_group` = 53
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.264 ms 1 /classes/tax/TaxRulesTaxManager.php:100
750
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 4125
ORDER BY `position`
0.264 ms 1 Yes /classes/Product.php:3539
759
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 4121
ORDER BY `position`
0.264 ms 1 Yes /classes/Product.php:3539
702
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 4149
ORDER BY `position`
0.261 ms 1 Yes /classes/Product.php:3539
95
SELECT SQL_NO_CACHE tr.*
FROM `prstshp_tax_rule` tr
JOIN `prstshp_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 6
AND tr.`id_tax_rules_group` = 53
AND tr.`id_state` IN (0, 362)
AND ('08720' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '08720')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.261 ms 2 /classes/tax/TaxRulesTaxManager.php:100
621
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 4124 LIMIT 1
0.260 ms 1 /classes/SpecificPrice.php:435
182
SELECT SQL_NO_CACHE product_attribute_shop.`price`
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.`id_product_attribute` = 1802 LIMIT 1
0.259 ms 1 /classes/Combination.php:560
528
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4134)
0.259 ms 1 /classes/Product.php:3860
468
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4144)
0.258 ms 1 /classes/Product.php:3860
33
SELECT SQL_NO_CACHE id_shop
FROM `prstshp_currency_shop`
WHERE `id_currency` = 2
AND id_shop = 1 LIMIT 1
0.257 ms 1 /classes/ObjectModel.php:1727
373
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1287 AND id_shop=1 LIMIT 1
0.257 ms 1 /classes/Product.php:6884
179
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `prstshp_category_lang` cl
WHERE `id_lang` = 2
AND cl.id_shop = 1 
AND cl.`id_category` = 15 LIMIT 1
0.256 ms 1 /classes/Category.php:1373
708
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 4146
ORDER BY `position`
0.256 ms 1 Yes /classes/Product.php:3539
744
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 4127
ORDER BY `position`
0.255 ms 1 Yes /classes/Product.php:3539
722
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (4922) AND il.`id_lang` = 2 ORDER by i.`position`
0.254 ms 1 Yes /classes/Product.php:2915
726
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 4139
ORDER BY `position`
0.254 ms 1 Yes /classes/Product.php:3539
776
SELECT SQL_NO_CACHE 1 FROM `prstshp_cart_rule` WHERE ((date_to >= "2026-04-13 00:00:00" AND date_to <= "2026-04-13 23:59:59") OR (date_from >= "2026-04-13 00:00:00" AND date_from <= "2026-04-13 23:59:59") OR (date_from < "2026-04-13 00:00:00" AND date_to > "2026-04-13 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
0.254 ms 7 /classes/CartRule.php:357
24
SELECT SQL_NO_CACHE c.id_currency
FROM `prstshp_currency` c
WHERE (iso_code = 'EUR') LIMIT 1
0.253 ms 1 /classes/Currency.php:893
732
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 4131
ORDER BY `position`
0.253 ms 1 Yes /classes/Product.php:3539
714
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 4144
ORDER BY `position`
0.251 ms 1 Yes /classes/Product.php:3539
756
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 4122
ORDER BY `position`
0.250 ms 1 Yes /classes/Product.php:3539
355
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 14 LIMIT 1
0.249 ms 1 /classes/Product.php:5670
69
SELECT SQL_NO_CACHE *
FROM `prstshp_state` a
WHERE (a.`id_state` = 362) LIMIT 1
0.248 ms 1 /src/Adapter/EntityMapper.php:71
144
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1235) AND (b.`id_shop` = 1) LIMIT 1
0.248 ms 1 /src/Adapter/EntityMapper.php:71
540
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4131)
0.247 ms 1 /classes/Product.php:3860
723
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 4140
ORDER BY `position`
0.247 ms 1 Yes /classes/Product.php:3539
35
SELECT SQL_NO_CACHE *
FROM `prstshp_group_lang`
WHERE `id_group` = 1
0.246 ms 2 /src/Adapter/EntityMapper.php:79
119
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1222) AND (b.`id_shop` = 1) LIMIT 1
0.246 ms 1 /src/Adapter/EntityMapper.php:71
330
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `prstshp_category_lang` cl
WHERE `id_lang` = 2
AND cl.id_shop = 1 
AND cl.`id_category` = 17 LIMIT 1
0.246 ms 1 /classes/Category.php:1373
369
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1287 LIMIT 1
0.246 ms 1 /classes/SpecificPrice.php:435
341
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1270
ORDER BY f.position ASC
0.246 ms 1 Yes /classes/Product.php:6024
332
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1270) AND (b.`id_shop` = 1) LIMIT 1
0.245 ms 1 /src/Adapter/EntityMapper.php:71
415
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4149) AND (b.`id_shop` = 1) LIMIT 1
0.245 ms 1 /src/Adapter/EntityMapper.php:71
425
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4149
ORDER BY f.position ASC
0.244 ms 1 Yes /classes/Product.php:6024
711
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 4145
ORDER BY `position`
0.244 ms 1 Yes /classes/Product.php:3539
717
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 4143
ORDER BY `position`
0.244 ms 1 Yes /classes/Product.php:3539
612
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4125)
0.243 ms 1 /classes/Product.php:3860
87
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE `from` BETWEEN '2026-04-13 00:00:00' AND '2026-04-13 23:59:59' LIMIT 1
0.242 ms 1 /classes/SpecificPrice.php:377
777
SELECT SQL_NO_CACHE 1 FROM `prstshp_cart_rule` WHERE ((date_to >= "2026-04-13 00:00:00" AND date_to <= "2026-04-13 23:59:59") OR (date_from >= "2026-04-13 00:00:00" AND date_from <= "2026-04-13 23:59:59") OR (date_from < "2026-04-13 00:00:00" AND date_to > "2026-04-13 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
0.242 ms 7 /classes/CartRule.php:357
158
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1236
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.241 ms 1 /classes/SpecificPrice.php:256
180
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 15 LIMIT 1
0.240 ms 1 /classes/Product.php:5670
729
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 4134
ORDER BY `position`
0.240 ms 1 Yes /classes/Product.php:3539
379
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 17 LIMIT 1
0.239 ms 1 /classes/Product.php:5670
768
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 4118
ORDER BY `position`
0.239 ms 1 Yes /classes/Product.php:3539
307
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1264) AND (b.`id_shop` = 1) LIMIT 1
0.239 ms 1 /src/Adapter/EntityMapper.php:71
175
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1242) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.238 ms 1 /classes/stock/StockAvailable.php:453
283
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1262) AND (b.`id_shop` = 1) LIMIT 1
0.238 ms 1 /src/Adapter/EntityMapper.php:71
600
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4126)
0.238 ms 1 /classes/Product.php:3860
367
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 14 LIMIT 1
0.237 ms 1 /classes/Product.php:5670
440
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4146) AND (b.`id_shop` = 1) LIMIT 1
0.237 ms 1 /src/Adapter/EntityMapper.php:71
271
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1260) AND (b.`id_shop` = 1) LIMIT 1
0.236 ms 1 /src/Adapter/EntityMapper.php:71
552
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4130)
0.236 ms 1 /classes/Product.php:3860
326
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1265) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.236 ms 1 /classes/stock/StockAvailable.php:453
339
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1270) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.235 ms 1 /classes/stock/StockAvailable.php:453
140
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1224
ORDER BY f.position ASC
0.234 ms 1 Yes /classes/Product.php:6024
215
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1248) AND (b.`id_shop` = 1) LIMIT 1
0.234 ms 1 /src/Adapter/EntityMapper.php:71
428
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4147) AND (b.`id_shop` = 1) LIMIT 1
0.234 ms 1 /src/Adapter/EntityMapper.php:71
648
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4121)
0.234 ms 1 /classes/Product.php:3860
420
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4149)
0.234 ms 1 /classes/Product.php:3860
696
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4117)
0.234 ms 1 /classes/Product.php:3860
116
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1216
ORDER BY f.position ASC
0.233 ms 1 Yes /classes/Product.php:6024
636
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4122)
0.233 ms 1 /classes/Product.php:3860
522
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4134
AND image_shop.`cover` = 1 LIMIT 1
0.231 ms 1 /classes/Product.php:3570
534
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4131
AND image_shop.`cover` = 1 LIMIT 1
0.231 ms 1 /classes/Product.php:3570
672
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4119)
0.231 ms 1 /classes/Product.php:3860
762
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 4120
ORDER BY `position`
0.231 ms 1 Yes /classes/Product.php:3539
770
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (4898) AND il.`id_lang` = 2 ORDER by i.`position`
0.231 ms 1 Yes /classes/Product.php:2915
128
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1222
ORDER BY f.position ASC
0.230 ms 1 Yes /classes/Product.php:6024
504
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4140)
0.229 ms 1 /classes/Product.php:3860
660
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4120)
0.229 ms 1 /classes/Product.php:3860
199
SELECT SQL_NO_CACHE product_attribute_shop.`price`
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.`id_product_attribute` = 1803 LIMIT 1
0.228 ms 1 /classes/Combination.php:560
569
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4129
ORDER BY f.position ASC
0.228 ms 1 Yes /classes/Product.php:6024
437
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4147
ORDER BY f.position ASC
0.226 ms 1 Yes /classes/Product.php:6024
227
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1251) AND (b.`id_shop` = 1) LIMIT 1
0.225 ms 1 /src/Adapter/EntityMapper.php:71
319
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1265) AND (b.`id_shop` = 1) LIMIT 1
0.225 ms 1 /src/Adapter/EntityMapper.php:71
606
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4125
AND image_shop.`cover` = 1 LIMIT 1
0.222 ms 1 /classes/Product.php:3570
516
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4139)
0.221 ms 1 /classes/Product.php:3860
30
SELECT SQL_NO_CACHE `id_lang` FROM `prstshp_lang`
WHERE `locale` = 'es-es'
OR `language_code` = 'es-es' LIMIT 1
0.220 ms 2 /classes/Language.php:880
183
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1245 LIMIT 1
0.220 ms 1 /classes/SpecificPrice.php:435
710
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (4926) AND il.`id_lang` = 2 ORDER by i.`position`
0.218 ms 1 Yes /classes/Product.php:2915
738
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 4129
ORDER BY `position`
0.218 ms 1 Yes /classes/Product.php:3539
736
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 4130
0.217 ms 1 /classes/Product.php:2899
519
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 4139) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.216 ms 1 /classes/stock/StockAvailable.php:453
630
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4122
AND image_shop.`cover` = 1 LIMIT 1
0.216 ms 1 /classes/Product.php:3570
666
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4119
AND image_shop.`cover` = 1 LIMIT 1
0.216 ms 1 /classes/Product.php:3570
707
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (4927) AND il.`id_lang` = 2 ORDER by i.`position`
0.215 ms 1 Yes /classes/Product.php:2915
576
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4128)
0.215 ms 1 /classes/Product.php:3860
716
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (4924) AND il.`id_lang` = 2 ORDER by i.`position`
0.215 ms 1 Yes /classes/Product.php:2915
337
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1270 AND id_shop=1 LIMIT 1
0.213 ms 1 /classes/Product.php:6884
737
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (4910) AND il.`id_lang` = 2 ORDER by i.`position`
0.213 ms 1 Yes /classes/Product.php:2915
61
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 124) AND (b.`id_shop` = 1) LIMIT 1
0.211 ms 1 /src/Adapter/EntityMapper.php:71
474
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4143
AND image_shop.`cover` = 1 LIMIT 1
0.209 ms 1 /classes/Product.php:3570
510
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4139
AND image_shop.`cover` = 1 LIMIT 1
0.209 ms 1 /classes/Product.php:3570
250
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1252) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.209 ms 1 /classes/stock/StockAvailable.php:453
618
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4124
AND image_shop.`cover` = 1 LIMIT 1
0.209 ms 1 /classes/Product.php:3570
713
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (4925) AND il.`id_lang` = 2 ORDER by i.`position`
0.207 ms 1 Yes /classes/Product.php:2915
743
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (4908) AND il.`id_lang` = 2 ORDER by i.`position`
0.207 ms 1 Yes /classes/Product.php:2915
752
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (4905) AND il.`id_lang` = 2 ORDER by i.`position`
0.206 ms 1 Yes /classes/Product.php:2915
486
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4142
AND image_shop.`cover` = 1 LIMIT 1
0.205 ms 1 /classes/Product.php:3570
704
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (4929) AND il.`id_lang` = 2 ORDER by i.`position`
0.205 ms 1 Yes /classes/Product.php:2915
92
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1207 AND id_shop=1 LIMIT 1
0.204 ms 1 /classes/Product.php:6884
450
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4145
AND image_shop.`cover` = 1 LIMIT 1
0.204 ms 1 /classes/Product.php:3570
764
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (4900) AND il.`id_lang` = 2 ORDER by i.`position`
0.203 ms 1 Yes /classes/Product.php:2915
761
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (4901) AND il.`id_lang` = 2 ORDER by i.`position`
0.202 ms 1 Yes /classes/Product.php:2915
481
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 4143 AND id_shop=1 LIMIT 1
0.202 ms 1 /classes/Product.php:6884
498
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4140
AND image_shop.`cover` = 1 LIMIT 1
0.202 ms 1 /classes/Product.php:3570
541
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 4131 AND id_shop=1 LIMIT 1
0.202 ms 1 /classes/Product.php:6884
294
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.201 ms 1 /classes/Product.php:5670
725
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (4920) AND il.`id_lang` = 2 ORDER by i.`position`
0.201 ms 1 Yes /classes/Product.php:2915
728
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (4919) AND il.`id_lang` = 2 ORDER by i.`position`
0.201 ms 1 Yes /classes/Product.php:2915
734
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (4911) AND il.`id_lang` = 2 ORDER by i.`position`
0.201 ms 1 Yes /classes/Product.php:2915
749
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (4906) AND il.`id_lang` = 2 ORDER by i.`position`
0.201 ms 1 Yes /classes/Product.php:2915
88
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE `to` BETWEEN '2026-04-13 00:00:00' AND '2026-04-13 23:59:59' LIMIT 1
0.200 ms 1 /classes/SpecificPrice.php:381
755
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (4904) AND il.`id_lang` = 2 ORDER by i.`position`
0.199 ms 1 Yes /classes/Product.php:2915
775
SELECT SQL_NO_CACHE 1 FROM prstshp_cart_product cp INNER JOIN prstshp_product p
ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps
ON (ps.id_shop = cp.id_shop AND ps.id_product = p.id_product) WHERE cp.id_cart=0 LIMIT 1
0.199 ms 1 /classes/Cart.php:4250
402
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a0
LEFT JOIN `prstshp_category_lang` `a1` ON (a0.`id_category` = a1.`id_category`)
WHERE (a0.`nleft` < 2) AND (a0.`nright` > 197) AND (a1.`id_lang` = 2) AND (a1.`id_shop` = 1)
ORDER BY a0.`nleft` asc
0.199 ms 1 /classes/PrestaShopCollection.php:383
758
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (4902) AND il.`id_lang` = 2 ORDER by i.`position`
0.199 ms 1 Yes /classes/Product.php:2915
767
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (4899) AND il.`id_lang` = 2 ORDER by i.`position`
0.199 ms 1 Yes /classes/Product.php:2915
773
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (4897) AND il.`id_lang` = 2 ORDER by i.`position`
0.198 ms 1 Yes /classes/Product.php:2915
654
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4120
AND image_shop.`cover` = 1 LIMIT 1
0.198 ms 1 /classes/Product.php:3570
678
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4118
AND image_shop.`cover` = 1 LIMIT 1
0.198 ms 1 /classes/Product.php:3570
690
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4117
AND image_shop.`cover` = 1 LIMIT 1
0.198 ms 1 /classes/Product.php:3570
76
SELECT SQL_NO_CACHE `id_configuration`
FROM `prstshp_configuration`
WHERE name = 'PS_ACCOUNTS_SHOP_STATUS'
AND (id_shop_group IS NULL OR id_shop_group = 0) AND (id_shop IS NULL OR id_shop = 0) LIMIT 1
0.197 ms 1 /classes/Configuration.php:133
821
SELECT SQL_NO_CACHE `id_guest`
FROM `prstshp_connections`
WHERE `id_guest` = 16684190
AND `date_add` > '2026-04-13 11:16:00'
AND id_shop IN (1) 
ORDER BY `date_add` DESC LIMIT 1
0.197 ms 1 Yes /classes/Connection.php:168
446
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 4146 AND `id_group` = 1 LIMIT 1
0.197 ms 0 /classes/GroupReduction.php:153
719
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (4923) AND il.`id_lang` = 2 ORDER by i.`position`
0.197 ms 1 Yes /classes/Product.php:2915
731
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (4914) AND il.`id_lang` = 2 ORDER by i.`position`
0.197 ms 1 Yes /classes/Product.php:2915
26
SELECT SQL_NO_CACHE `id_lang` FROM `prstshp_lang`
WHERE `locale` = 'es-es'
OR `language_code` = 'es-es' LIMIT 1
0.196 ms 2 /classes/Language.php:880
350
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1274 AND `id_group` = 1 LIMIT 1
0.196 ms 0 /classes/GroupReduction.php:153
558
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4129
AND image_shop.`cover` = 1 LIMIT 1
0.196 ms 1 /classes/Product.php:3570
642
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4121
AND image_shop.`cover` = 1 LIMIT 1
0.196 ms 1 /classes/Product.php:3570
70
SELECT SQL_NO_CACHE id_required_field, object_name, field_name
FROM prstshp_required_field
0.195 ms 1 /classes/ObjectModel.php:1592
619
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.195 ms 1 /classes/Product.php:5670
746
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (4907) AND il.`id_lang` = 2 ORDER by i.`position`
0.194 ms 1 Yes /classes/Product.php:2915
260
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 15 LIMIT 1
0.194 ms 1 /classes/Product.php:5670
135
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1224)
0.192 ms 1 /classes/Product.php:3860
105
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1216
AND image_shop.`cover` = 1 LIMIT 1
0.190 ms 1 /classes/Product.php:3570
324
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1265 AND id_shop=1 LIMIT 1
0.188 ms 1 /classes/Product.php:6884
546
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4130
AND image_shop.`cover` = 1 LIMIT 1
0.188 ms 1 /classes/Product.php:3570
585
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 4127 LIMIT 1
0.188 ms 1 /classes/SpecificPrice.php:435
374
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1287 AND `id_group` = 1 LIMIT 1
0.188 ms 0 /classes/GroupReduction.php:153
462
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4144
AND image_shop.`cover` = 1 LIMIT 1
0.187 ms 1 /classes/Product.php:3570
123
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1222)
0.186 ms 1 /classes/Product.php:3860
594
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4126
AND image_shop.`cover` = 1 LIMIT 1
0.186 ms 1 /classes/Product.php:3570
49
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 70) AND (b.`id_shop` = 1) LIMIT 1
0.185 ms 1 /src/Adapter/EntityMapper.php:71
724
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 4140
0.185 ms 1 /classes/Product.php:2899
358
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1286
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.184 ms 0 /classes/SpecificPrice.php:256
348
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1274)
0.183 ms 1 /classes/Product.php:3860
781
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module` WHERE `name` = "ps_languageselector" LIMIT 1
0.183 ms 1 /classes/module/Module.php:2664
266
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1257) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.182 ms 1 /classes/stock/StockAvailable.php:453
111
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1216)
0.181 ms 1 /classes/Product.php:3860
511
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.181 ms 1 /classes/Product.php:5670
370
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1287
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.179 ms 0 /classes/SpecificPrice.php:256
583
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.179 ms 1 /classes/Product.php:5670
413
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4149
AND image_shop.`cover` = 1 LIMIT 1
0.178 ms 1 /classes/Product.php:3570
564
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4129)
0.176 ms 1 /classes/Product.php:3860
166
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1242
AND image_shop.`cover` = 1 LIMIT 1
0.176 ms 1 /classes/Product.php:3570
423
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 4149) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.176 ms 1 /classes/stock/StockAvailable.php:453
384
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1289)
0.174 ms 1 /classes/Product.php:3860
525
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 4134 LIMIT 1
0.172 ms 1 /classes/SpecificPrice.php:435
247
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1252)
0.171 ms 1 /classes/Product.php:3860
386
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1289 AND `id_group` = 1 LIMIT 1
0.171 ms 0 /classes/GroupReduction.php:153
360
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1286)
0.169 ms 1 /classes/Product.php:3860
426
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4147
AND image_shop.`cover` = 1 LIMIT 1
0.169 ms 1 /classes/Product.php:3570
263
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1257)
0.167 ms 1 /classes/Product.php:3860
432
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4147)
0.167 ms 1 /classes/Product.php:3860
780
SELECT SQL_NO_CACHE COUNT(DISTINCT c.id_currency) FROM `prstshp_currency` c
LEFT JOIN prstshp_currency_shop cs ON (cs.id_currency = c.id_currency AND cs.id_shop = 1)
WHERE c.`active` = 1 AND c.`deleted` = 0 LIMIT 1
0.167 ms 2 /classes/Currency.php:1134
117
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1222
AND image_shop.`cover` = 1 LIMIT 1
0.166 ms 1 /classes/Product.php:3570
372
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1287)
0.166 ms 1 /classes/Product.php:3860
444
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4146)
0.166 ms 1 /classes/Product.php:3860
603
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 4126) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.164 ms 1 /classes/stock/StockAvailable.php:453
727
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 4139
0.161 ms 1 /classes/Product.php:2899
141
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1235
AND image_shop.`cover` = 1 LIMIT 1
0.159 ms 2 /classes/Product.php:3570
733
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 4131
0.159 ms 1 /classes/Product.php:2899
826
SELECT SQL_NO_CACHE m.* FROM `prstshp_module` m
0.158 ms 102 /classes/module/Module.php:1724
129
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1224
AND image_shop.`cover` = 1 LIMIT 1
0.158 ms 1 /classes/Product.php:3570
609
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 4125 LIMIT 1
0.157 ms 1 /classes/SpecificPrice.php:435
657
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 4120 LIMIT 1
0.157 ms 1 /classes/SpecificPrice.php:435
622
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 4124
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.156 ms 0 /classes/SpecificPrice.php:256
38
SELECT SQL_NO_CACHE ctg.`id_group`
FROM prstshp_category_group ctg
WHERE ctg.`id_category` = 2 AND ctg.`id_group` = 1 LIMIT 1
0.156 ms 1 /classes/Category.php:1751
633
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 4122 LIMIT 1
0.156 ms 1 /classes/SpecificPrice.php:435
417
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 4149 LIMIT 1
0.155 ms 1 /classes/SpecificPrice.php:435
531
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 4134) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.154 ms 1 /classes/stock/StockAvailable.php:453
579
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 4128) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.153 ms 1 /classes/stock/StockAvailable.php:453
54
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 87) AND (b.`id_shop` = 1) LIMIT 1
0.151 ms 1 /src/Adapter/EntityMapper.php:71
390
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1310
AND image_shop.`cover` = 1 LIMIT 1
0.150 ms 1 /classes/Product.php:3570
537
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 4131 LIMIT 1
0.150 ms 1 /classes/SpecificPrice.php:435
543
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 4131) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.150 ms 1 /classes/stock/StockAvailable.php:453
785
SELECT SQL_NO_CACHE SUM(`quantity`)
FROM `prstshp_cart_product`
WHERE `id_cart` = 0 LIMIT 1
0.150 ms 1 /classes/Cart.php:1300
823
SELECT SQL_NO_CACHE `id_page`
FROM `prstshp_page`
WHERE `id_page_type` = 5 AND `id_object` = 2 LIMIT 1
0.150 ms 1 /classes/Page.php:83
196
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1246
AND image_shop.`cover` = 1 LIMIT 1
0.149 ms 1 /classes/Product.php:3570
483
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 4143) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.149 ms 1 /classes/stock/StockAvailable.php:453
549
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 4130 LIMIT 1
0.149 ms 1 /classes/SpecificPrice.php:435
639
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 4122) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.149 ms 1 /classes/stock/StockAvailable.php:453
675
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 4119) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.149 ms 1 /classes/stock/StockAvailable.php:453
453
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 4145 LIMIT 1
0.148 ms 1 /classes/SpecificPrice.php:435
513
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 4139 LIMIT 1
0.148 ms 1 /classes/SpecificPrice.php:435
627
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 4124) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.148 ms 1 /classes/stock/StockAvailable.php:453
774
SELECT SQL_NO_CACHE c.id_elementor FROM prstshp_iqit_elementor_category c WHERE c.id_category = 2 LIMIT 1
0.148 ms 1 /modules/iqitelementor/src/IqitElementorCategory.php:87
477
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 4143 LIMIT 1
0.148 ms 1 /classes/SpecificPrice.php:435
597
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 4126 LIMIT 1
0.147 ms 1 /classes/SpecificPrice.php:435
681
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 4118 LIMIT 1
0.147 ms 1 /classes/SpecificPrice.php:435
101
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1207) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.146 ms 1 /classes/stock/StockAvailable.php:453
438
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4146
AND image_shop.`cover` = 1 LIMIT 1
0.146 ms 1 /classes/Product.php:3570
570
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4128
AND image_shop.`cover` = 1 LIMIT 1
0.146 ms 1 /classes/Product.php:3570
693
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 4117 LIMIT 1
0.145 ms 1 /classes/SpecificPrice.php:435
29
SELECT SQL_NO_CACHE *
FROM `prstshp_currency` a
LEFT JOIN `prstshp_currency_lang` `b` ON a.`id_currency` = b.`id_currency` AND b.`id_lang` = 2
LEFT JOIN `prstshp_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
0.145 ms 1 /src/Adapter/EntityMapper.php:71
495
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 4142) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.145 ms 1 /classes/stock/StockAvailable.php:453
687
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 4118) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.145 ms 1 /classes/stock/StockAvailable.php:453
772
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 4117
0.145 ms 1 /classes/Product.php:2899
812
SELECT SQL_NO_CACHE * FROM prstshp_corewhatsapp WHERE core_status=1 AND FIND_IN_SET('2', `core_language`)  LIMIT 0,1
0.145 ms 1 /modules/corewhatsapp/corewhatsapp.php:169
285
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1262
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.143 ms 0 /classes/SpecificPrice.php:256
489
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 4142 LIMIT 1
0.143 ms 1 /classes/SpecificPrice.php:435
615
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 4125) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.143 ms 1 /classes/stock/StockAvailable.php:453
517
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 4139 AND id_shop=1 LIMIT 1
0.142 ms 1 /classes/Product.php:6884
589
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 4127 AND id_shop=1 LIMIT 1
0.142 ms 1 /classes/Product.php:6884
699
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 4117) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.142 ms 1 /classes/stock/StockAvailable.php:453
459
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 4145) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.141 ms 1 /classes/stock/StockAvailable.php:453
712
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 4145
0.141 ms 1 /classes/Product.php:2899
501
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 4140 LIMIT 1
0.141 ms 1 /classes/SpecificPrice.php:435
637
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 4122 AND id_shop=1 LIMIT 1
0.141 ms 1 /classes/Product.php:6884
645
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 4121 LIMIT 1
0.141 ms 1 /classes/SpecificPrice.php:435
651
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 4121) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.141 ms 1 /classes/stock/StockAvailable.php:453
663
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 4120) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.140 ms 1 /classes/stock/StockAvailable.php:453
742
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 4128
0.140 ms 1 /classes/Product.php:2899
106
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 14 LIMIT 1
0.139 ms 1 /classes/Product.php:5670
706
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 4147
0.139 ms 1 /classes/Product.php:2899
760
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 4121
0.139 ms 1 /classes/Product.php:2899
669
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 4119 LIMIT 1
0.138 ms 1 /classes/SpecificPrice.php:435
100
SELECT SQL_NO_CACHE tr.*
FROM `prstshp_tax_rule` tr
JOIN `prstshp_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 6
AND tr.`id_tax_rules_group` = 0
AND tr.`id_state` IN (0, 362)
AND ('08720' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '08720')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.138 ms 0 /classes/tax/TaxRulesTaxManager.php:100
465
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 4144 LIMIT 1
0.137 ms 1 /classes/SpecificPrice.php:435
553
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 4130 AND id_shop=1 LIMIT 1
0.137 ms 1 /classes/Product.php:6884
703
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 4149
0.137 ms 1 /classes/Product.php:2899
766
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 4119
0.137 ms 1 /classes/Product.php:2899
718
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 4143
0.136 ms 1 /classes/Product.php:2899
748
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 4126
0.136 ms 1 /classes/Product.php:2899
84
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 0 LIMIT 1
0.135 ms 1 /classes/SpecificPrice.php:426
487
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.135 ms 1 /classes/Product.php:5670
555
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 4130) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.135 ms 1 /classes/stock/StockAvailable.php:453
730
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 4134
0.135 ms 1 /classes/Product.php:2899
507
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 4140) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.134 ms 1 /classes/stock/StockAvailable.php:453
751
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 4125
0.134 ms 1 /classes/Product.php:2899
44
SELECT SQL_NO_CACHE * FROM `prstshp_image_type`
0.133 ms 8 /classes/ImageType.php:161
314
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1264) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.133 ms 1 /classes/stock/StockAvailable.php:453
73
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module_shop` WHERE `id_module` = 61 AND `id_shop` = 1 LIMIT 1
0.132 ms 1 /classes/module/Module.php:2137
550
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 4130
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.132 ms 0 /classes/SpecificPrice.php:256
754
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 4124
0.132 ms 1 /classes/Product.php:2899
721
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 4142
0.131 ms 1 /classes/Product.php:2899
631
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.130 ms 1 /classes/Product.php:5670
709
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 4146
0.130 ms 1 /classes/Product.php:2899
715
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 4144
0.130 ms 1 /classes/Product.php:2899
757
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 4122
0.130 ms 1 /classes/Product.php:2899
763
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 4120
0.130 ms 1 /classes/Product.php:2899
278
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1260) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.129 ms 1 /classes/stock/StockAvailable.php:453
535
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.129 ms 1 /classes/Product.php:5670
23
SELECT SQL_NO_CACHE value FROM `prstshp_configuration` WHERE `name` = "PS_MULTISHOP_FEATURE_ACTIVE" LIMIT 1
0.128 ms 1 /classes/shop/Shop.php:1183
547
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.127 ms 1 /classes/Product.php:5670
674
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 4119 AND `id_group` = 1 LIMIT 1
0.127 ms 0 /classes/GroupReduction.php:153
769
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 4118
0.127 ms 1 /classes/Product.php:2899
163
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1236) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.126 ms 1 /classes/stock/StockAvailable.php:453
590
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 4127 AND `id_group` = 1 LIMIT 1
0.126 ms 0 /classes/GroupReduction.php:153
475
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.126 ms 1 /classes/Product.php:5670
817
SELECT SQL_NO_CACHE psgdprl.message FROM `prstshp_psgdpr_consent` psgdpr
LEFT JOIN prstshp_psgdpr_consent_lang psgdprl ON (psgdpr.id_gdpr_consent = psgdprl.id_gdpr_consent)
WHERE psgdpr.id_module = 22 AND psgdprl.id_lang =2 LIMIT 1
0.125 ms 8 /modules/psgdpr/classes/GDPRConsent.php:108
745
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 4127
0.125 ms 1 /classes/Product.php:2899
561
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 4129 LIMIT 1
0.124 ms 1 /classes/SpecificPrice.php:435
607
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.123 ms 1 /classes/Product.php:5670
457
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 4145 AND id_shop=1 LIMIT 1
0.123 ms 1 /classes/Product.php:6884
469
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 4144 AND id_shop=1 LIMIT 1
0.122 ms 1 /classes/Product.php:6884
655
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.122 ms 1 /classes/Product.php:5670
559
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.122 ms 1 /classes/Product.php:5670
494
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 4142 AND `id_group` = 1 LIMIT 1
0.121 ms 0 /classes/GroupReduction.php:153
649
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 4121 AND id_shop=1 LIMIT 1
0.121 ms 1 /classes/Product.php:6884
667
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.121 ms 1 /classes/Product.php:5670
451
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.120 ms 1 /classes/Product.php:5670
32
SELECT SQL_NO_CACHE *
FROM `prstshp_currency_lang`
WHERE `id_currency` = 2
0.120 ms 2 /src/Adapter/EntityMapper.php:79
108
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1216 LIMIT 1
0.120 ms 1 /classes/SpecificPrice.php:435
505
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 4140 AND id_shop=1 LIMIT 1
0.120 ms 1 /classes/Product.php:6884
613
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 4125 AND id_shop=1 LIMIT 1
0.120 ms 1 /classes/Product.php:6884
625
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 4124 AND id_shop=1 LIMIT 1
0.120 ms 1 /classes/Product.php:6884
673
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 4119 AND id_shop=1 LIMIT 1
0.120 ms 1 /classes/Product.php:6884
126
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1222) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.119 ms 1 /classes/stock/StockAvailable.php:453
661
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 4120 AND id_shop=1 LIMIT 1
0.119 ms 1 /classes/Product.php:6884
523
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.118 ms 1 /classes/Product.php:5670
685
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 4118 AND id_shop=1 LIMIT 1
0.118 ms 1 /classes/Product.php:6884
478
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 4143
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.117 ms 0 /classes/SpecificPrice.php:256
529
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 4134 AND id_shop=1 LIMIT 1
0.117 ms 1 /classes/Product.php:6884
679
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.117 ms 1 /classes/Product.php:5670
691
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.117 ms 1 /classes/Product.php:5670
421
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 4149 AND id_shop=1 LIMIT 1
0.117 ms 1 /classes/Product.php:6884
27
SELECT SQL_NO_CACHE `id_lang` FROM `prstshp_lang`
WHERE `locale` = 'es-es'
OR `language_code` = 'es-es' LIMIT 1
0.116 ms 2 /classes/Language.php:880
601
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 4126 AND id_shop=1 LIMIT 1
0.115 ms 1 /classes/Product.php:6884
595
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.115 ms 1 /classes/Product.php:5670
634
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 4122
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.115 ms 0 /classes/SpecificPrice.php:256
454
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 4145
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.114 ms 0 /classes/SpecificPrice.php:256
466
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 4144
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.114 ms 0 /classes/SpecificPrice.php:256
499
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.114 ms 1 /classes/Product.php:5670
526
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 4134
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.114 ms 0 /classes/SpecificPrice.php:256
586
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 4127
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.114 ms 0 /classes/SpecificPrice.php:256
602
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 4126 AND `id_group` = 1 LIMIT 1
0.114 ms 0 /classes/GroupReduction.php:153
490
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 4142
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.113 ms 0 /classes/SpecificPrice.php:256
538
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 4131
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.113 ms 0 /classes/SpecificPrice.php:256
778
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module` WHERE `name` = "iqitlinksmanager" LIMIT 1
0.113 ms 1 /classes/module/Module.php:2664
818
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module` WHERE `name` = "iqitcookielaw" LIMIT 1
0.113 ms 1 /classes/module/Module.php:2664
151
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1235) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.112 ms 1 /classes/stock/StockAvailable.php:453
610
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 4125
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.112 ms 0 /classes/SpecificPrice.php:256
670
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 4119
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.112 ms 0 /classes/SpecificPrice.php:256
233
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1251) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.111 ms 1 /classes/stock/StockAvailable.php:453
258
SELECT SQL_NO_CACHE *
FROM `prstshp_product_attribute_lang`
WHERE `id_product_attribute` = 1807
0.111 ms 2 /src/Adapter/EntityMapper.php:79
646
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 4121
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.111 ms 0 /classes/SpecificPrice.php:256
822
SELECT SQL_NO_CACHE id_page_type
FROM prstshp_page_type
WHERE name = 'category' LIMIT 1
0.111 ms 1 /classes/Page.php:100
482
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 4143 AND `id_group` = 1 LIMIT 1
0.111 ms 0 /classes/GroupReduction.php:153
598
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 4126
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.111 ms 0 /classes/SpecificPrice.php:256
658
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 4120
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.111 ms 0 /classes/SpecificPrice.php:256
542
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 4131 AND `id_group` = 1 LIMIT 1
0.110 ms 0 /classes/GroupReduction.php:153
114
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1216) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.110 ms 1 /classes/stock/StockAvailable.php:453
643
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.110 ms 1 /classes/Product.php:5670
427
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.109 ms 1 /classes/Product.php:5670
463
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.109 ms 1 /classes/Product.php:5670
120
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1222 LIMIT 1
0.108 ms 1 /classes/SpecificPrice.php:435
145
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1235 LIMIT 1
0.108 ms 1 /classes/SpecificPrice.php:435
573
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 4128 LIMIT 1
0.108 ms 1 /classes/SpecificPrice.php:435
458
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 4145 AND `id_group` = 1 LIMIT 1
0.107 ms 0 /classes/GroupReduction.php:153
138
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1224) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.107 ms 1 /classes/stock/StockAvailable.php:453
429
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 4147 LIMIT 1
0.106 ms 1 /classes/SpecificPrice.php:435
626
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 4124 AND `id_group` = 1 LIMIT 1
0.106 ms 0 /classes/GroupReduction.php:153
662
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 4120 AND `id_group` = 1 LIMIT 1
0.106 ms 0 /classes/GroupReduction.php:153
132
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1224 LIMIT 1
0.106 ms 1 /classes/SpecificPrice.php:435
296
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1263 LIMIT 1
0.106 ms 1 /classes/SpecificPrice.php:435
493
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 4142 AND id_shop=1 LIMIT 1
0.106 ms 1 /classes/Product.php:6884
502
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 4140
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.106 ms 0 /classes/SpecificPrice.php:256
530
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 4134 AND `id_group` = 1 LIMIT 1
0.106 ms 0 /classes/GroupReduction.php:153
682
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 4118
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.106 ms 0 /classes/SpecificPrice.php:256
686
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 4118 AND `id_group` = 1 LIMIT 1
0.106 ms 0 /classes/GroupReduction.php:153
447
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 4146) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.105 ms 1 /classes/stock/StockAvailable.php:453
694
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 4117
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.105 ms 0 /classes/SpecificPrice.php:256
98
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1207 AND `id_group` = 1 LIMIT 1
0.105 ms 0 /classes/GroupReduction.php:153
470
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 4144 AND `id_group` = 1 LIMIT 1
0.105 ms 0 /classes/GroupReduction.php:153
816
SELECT SQL_NO_CACHE psgdpr.active FROM `prstshp_psgdpr_consent` psgdpr
WHERE psgdpr.id_module = 22 LIMIT 1
0.105 ms 8 /modules/psgdpr/classes/GDPRConsent.php:130
441
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 4146 LIMIT 1
0.104 ms 1 /classes/SpecificPrice.php:435
290
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1262) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.103 ms 1 /classes/stock/StockAvailable.php:453
554
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 4130 AND `id_group` = 1 LIMIT 1
0.103 ms 0 /classes/GroupReduction.php:153
567
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 4129) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.103 ms 1 /classes/stock/StockAvailable.php:453
650
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 4121 AND `id_group` = 1 LIMIT 1
0.103 ms 0 /classes/GroupReduction.php:153
222
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1248) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.102 ms 1 /classes/stock/StockAvailable.php:453
422
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 4149 AND `id_group` = 1 LIMIT 1
0.102 ms 0 /classes/GroupReduction.php:153
514
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 4139
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.102 ms 0 /classes/SpecificPrice.php:256
614
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 4125 AND `id_group` = 1 LIMIT 1
0.102 ms 0 /classes/GroupReduction.php:153
638
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 4122 AND `id_group` = 1 LIMIT 1
0.102 ms 0 /classes/GroupReduction.php:153
214
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.101 ms 1 /classes/Product.php:5670
229
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1251 LIMIT 1
0.101 ms 1 /classes/SpecificPrice.php:435
445
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 4146 AND id_shop=1 LIMIT 1
0.101 ms 1 /classes/Product.php:6884
697
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 4117 AND id_shop=1 LIMIT 1
0.101 ms 1 /classes/Product.php:6884
435
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 4147) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.100 ms 1 /classes/stock/StockAvailable.php:453
814
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module` WHERE `name` = "ps_emailsubscription" LIMIT 1
0.100 ms 1 /classes/module/Module.php:2664
698
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 4117 AND `id_group` = 1 LIMIT 1
0.099 ms 0 /classes/GroupReduction.php:153
416
SELECT SQL_NO_CACHE `name`
FROM `prstshp_manufacturer`
WHERE `id_manufacturer` = 17
AND `active` = 1 LIMIT 1
0.099 ms 0 /classes/Manufacturer.php:312
97
SELECT SQL_NO_CACHE *
FROM `prstshp_tax_lang`
WHERE `id_tax` = 53
0.098 ms 2 /src/Adapter/EntityMapper.php:79
433
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 4147 AND id_shop=1 LIMIT 1
0.097 ms 1 /classes/Product.php:6884
81
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `prstshp_category_lang` cl
WHERE `id_lang` = 2
AND cl.id_shop = 1 
AND cl.`id_category` = 14 LIMIT 1
0.095 ms 1 /classes/Category.php:1373
786
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module` WHERE `name` = "iqitmegamenu" LIMIT 1
0.095 ms 1 /classes/module/Module.php:2664
96
SELECT SQL_NO_CACHE *
FROM `prstshp_tax` a
WHERE (a.`id_tax` = 53) LIMIT 1
0.095 ms 1 /src/Adapter/EntityMapper.php:71
241
SELECT SQL_NO_CACHE *
FROM `prstshp_product_attribute_lang`
WHERE `id_product_attribute` = 1806
0.095 ms 2 /src/Adapter/EntityMapper.php:79
783
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module` WHERE `name` = "ps_currencyselector" LIMIT 1
0.094 ms 1 /classes/module/Module.php:2664
246
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1252 LIMIT 1
0.094 ms 1 /classes/SpecificPrice.php:435
118
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 14 LIMIT 1
0.091 ms 1 /classes/Product.php:5670
130
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 14 LIMIT 1
0.091 ms 1 /classes/Product.php:5670
518
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 4139 AND `id_group` = 1 LIMIT 1
0.091 ms 0 /classes/GroupReduction.php:153
574
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 4128
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.090 ms 0 /classes/SpecificPrice.php:256
133
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1224
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.090 ms 1 /classes/SpecificPrice.php:256
142
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `prstshp_category_lang` cl
WHERE `id_lang` = 2
AND cl.id_shop = 1 
AND cl.`id_category` = 18 LIMIT 1
0.090 ms 1 /classes/Category.php:1373
782
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module_shop` WHERE `id_module` = 27 AND `id_shop` = 1 LIMIT 1
0.090 ms 1 /classes/module/Module.php:2137
155
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.089 ms 1 /classes/Product.php:5670
506
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 4140 AND `id_group` = 1 LIMIT 1
0.089 ms 0 /classes/GroupReduction.php:153
197
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 15 LIMIT 1
0.088 ms 1 /classes/Product.php:5670
382
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1289
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.087 ms 1 /classes/SpecificPrice.php:256
565
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 4129 AND id_shop=1 LIMIT 1
0.087 ms 1 /classes/Product.php:6884
577
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 4128 AND id_shop=1 LIMIT 1
0.087 ms 1 /classes/Product.php:6884
779
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module_shop` WHERE `id_module` = 77 AND `id_shop` = 1 LIMIT 1
0.087 ms 1 /classes/module/Module.php:2137
112
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1216 AND id_shop=1 LIMIT 1
0.086 ms 1 /classes/Product.php:6884
276
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1260 AND id_shop=1 LIMIT 1
0.085 ms 1 /classes/Product.php:6884
288
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1262 AND id_shop=1 LIMIT 1
0.085 ms 1 /classes/Product.php:6884
571
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.085 ms 1 /classes/Product.php:5670
124
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1222 AND id_shop=1 LIMIT 1
0.084 ms 1 /classes/Product.php:6884
202
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1246 AND id_shop=1 LIMIT 1
0.084 ms 1 /classes/Product.php:6884
300
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1263 AND id_shop=1 LIMIT 1
0.084 ms 1 /classes/Product.php:6884
397
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1310 AND id_shop=1 LIMIT 1
0.084 ms 1 /classes/Product.php:6884
430
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 4147
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.084 ms 0 /classes/SpecificPrice.php:256
418
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 4149
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.084 ms 0 /classes/SpecificPrice.php:256
439
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.084 ms 1 /classes/Product.php:5670
136
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1224 AND id_shop=1 LIMIT 1
0.082 ms 1 /classes/Product.php:6884
819
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module_shop` WHERE `id_module` = 70 AND `id_shop` = 1 LIMIT 1
0.082 ms 1 /classes/module/Module.php:2137
185
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1245 AND id_shop=1 LIMIT 1
0.082 ms 1 /classes/Product.php:6884
125
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1222 AND `id_group` = 1 LIMIT 1
0.080 ms 0 /classes/GroupReduction.php:153
109
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1216
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.080 ms 0 /classes/SpecificPrice.php:256
784
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module_shop` WHERE `id_module` = 17 AND `id_shop` = 1 LIMIT 1
0.079 ms 1 /classes/module/Module.php:2137
99
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_group`
WHERE `id_group` = 1 LIMIT 1
0.078 ms 1 /classes/Group.php:151
170
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1242
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.078 ms 0 /classes/SpecificPrice.php:256
562
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 4129
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.078 ms 0 /classes/SpecificPrice.php:256
815
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module_shop` WHERE `id_module` = 22 AND `id_shop` = 1 LIMIT 1
0.078 ms 1 /classes/module/Module.php:2137
121
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1222
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.077 ms 0 /classes/SpecificPrice.php:256
787
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module_shop` WHERE `id_module` = 78 AND `id_shop` = 1 LIMIT 1
0.077 ms 1 /classes/module/Module.php:2137
82
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 14 LIMIT 1
0.076 ms 1 /classes/Product.php:5670
143
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.076 ms 1 /classes/Product.php:5670
273
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1260
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.076 ms 0 /classes/SpecificPrice.php:256
309
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1264
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.076 ms 0 /classes/SpecificPrice.php:256
394
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1310
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.076 ms 0 /classes/SpecificPrice.php:256
232
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1251 AND `id_group` = 1 LIMIT 1
0.074 ms 0 /classes/GroupReduction.php:153
442
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 4146
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.074 ms 0 /classes/SpecificPrice.php:256
162
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1236 AND `id_group` = 1 LIMIT 1
0.073 ms 0 /classes/GroupReduction.php:153
813
SELECT SQL_NO_CACHE domain,physical_uri FROM prstshp_shop_url
0.073 ms 1 /modules/corewhatsapp/corewhatsapp.php:179
113
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1216 AND `id_group` = 1 LIMIT 1
0.072 ms 0 /classes/GroupReduction.php:153
150
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1235 AND `id_group` = 1 LIMIT 1
0.071 ms 0 /classes/GroupReduction.php:153
174
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1242 AND `id_group` = 1 LIMIT 1
0.071 ms 0 /classes/GroupReduction.php:153
265
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1257 AND `id_group` = 1 LIMIT 1
0.071 ms 0 /classes/GroupReduction.php:153
186
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1245 AND `id_group` = 1 LIMIT 1
0.070 ms 0 /classes/GroupReduction.php:153
203
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1246 AND `id_group` = 1 LIMIT 1
0.070 ms 0 /classes/GroupReduction.php:153
249
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1252 AND `id_group` = 1 LIMIT 1
0.070 ms 0 /classes/GroupReduction.php:153
301
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1263 AND `id_group` = 1 LIMIT 1
0.070 ms 0 /classes/GroupReduction.php:153
434
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 4147 AND `id_group` = 1 LIMIT 1
0.070 ms 0 /classes/GroupReduction.php:153
578
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 4128 AND `id_group` = 1 LIMIT 1
0.070 ms 0 /classes/GroupReduction.php:153
137
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1224 AND `id_group` = 1 LIMIT 1
0.069 ms 0 /classes/GroupReduction.php:153
566
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 4129 AND `id_group` = 1 LIMIT 1
0.069 ms 0 /classes/GroupReduction.php:153

Doubles

52 queries
SELECT SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
52 queries
SELECT
            COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), XX) as deep_quantity,
            COALESCE(SUM(first_level_quantity), XX) as quantity
          FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, XX as pack_quantity
          FROM `prstshp_cart_product` cp
            WHERE cp.`id_product_attribute` = XX
            
            AND cp.`id_cart` = XX AND cp.`id_product` = XX UNION SELECT XX as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
          FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
            WHERE cp.`id_product_attribute` = XX
            
            AND cp.`id_cart` = XX AND p.`id_product_item` = XX AND (pr.`pack_stock_type` IN (XX,XX) OR (
            pr.`pack_stock_type` = XX
            AND XX = XX
        ))) as q LIMIT XX
49 queries
SELECT XX FROM `prstshp_specific_price` WHERE id_product = XX LIMIT XX
48 queries
SELECT image_shop.`id_image`
                    FROM `prstshp_image` i
                     INNER JOIN prstshp_image_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
                    WHERE i.`id_product` = XX
                    AND image_shop.`cover` = XX LIMIT XX
48 queries
SELECT name FROM prstshp_category_lang WHERE id_shop = XX AND id_lang = XX AND id_category = XX LIMIT XX
48 queries
SELECT *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = XX
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = XX
WHERE (a.`id_product` = XX) AND (b.`id_shop` = XX) LIMIT XX
48 queries
SELECT product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,XX) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = XX)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = XX)
WHERE (p.`id_product` = XX)
48 queries
                            SELECT `id_tax_rules_group`
                            FROM `prstshp_product_shop`
                            WHERE `id_product` = XX AND id_shop=XX LIMIT XX
48 queries
			SELECT `reduction`
			FROM `prstshp_product_group_reduction_cache`
			WHERE `id_product` = XX AND `id_group` = XX LIMIT XX
48 queries
                SELECT name, value, pf.id_feature, f.position, fvl.id_feature_value
                FROM prstshp_feature_product pf
                LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = XX)
                LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = XX)
                LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = XX)
                 INNER JOIN prstshp_feature_shop feature_shop
        ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = XX)
                WHERE pf.id_product = XX
                ORDER BY f.position ASC
43 queries
				SELECT `priority`, `id_specific_price_priority`
				FROM `prstshp_specific_price_priority`
				WHERE `id_product` = XX
				ORDER BY `id_specific_price_priority` DESC LIMIT XX
43 queries
			SELECT *, ( IF (`id_group` = XX, XX, XX) +  IF (`id_country` = XX, XX, XX) +  IF (`id_currency` = XX, XX, XX) +  IF (`id_shop` = XX, XX, XX) +  IF (`id_customer` = XX, XX, XX)) AS `score`
				FROM `prstshp_specific_price`
				WHERE
                `id_shop` IN (XX, XX) AND
                `id_currency` IN (XX, XX) AND
                `id_country` IN (XX, XX) AND
                `id_group` IN (XX, XX) AND `id_product` = XX AND `id_customer` = XX AND `id_product_attribute` = XX AND `id_cart` = XX  AND (`from` = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' >= `from`) AND (`to` = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' <= `to`)
				AND IF(`from_quantity` > XX, `from_quantity`, XX) <= XX ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT XX
24 queries
            SELECT image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
            FROM `prstshp_image` i
             INNER JOIN prstshp_image_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
            LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = XX)
            WHERE i.`id_product` = XX
            ORDER BY `position`
24 queries
SELECT `id_product_attribute`
            FROM `prstshp_product_attribute`
            WHERE `id_product` = XX
24 queries
            SELECT pai.`id_image`, pai.`id_product_attribute`, il.`legend`
            FROM `prstshp_product_attribute_image` pai
            LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
            LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
            WHERE pai.`id_product_attribute` IN (XX) AND il.`id_lang` = XX ORDER by i.`position`
24 queries
SELECT pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > XX, XX, XX)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
            FROM `prstshp_product_attribute` pa
             INNER JOIN prstshp_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX) LEFT JOIN prstshp_stock_available stock
            ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, XX) AND stock.id_shop = XX  AND stock.id_shop_group = XX  )
            JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
            JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
            JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = XX)
            JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
            WHERE pa.`id_product` IN (XX) AND ag.`is_color_group` = XX
            GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
            HAVING qty > XX
            ORDER BY a.`position` ASC;
20 queries
SELECT *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = XX
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = XX
WHERE (a.`id_category` = XX) AND (b.`id_shop` = XX) LIMIT XX
8 queries
SELECT `id_module` FROM `prstshp_module_shop` WHERE `id_module` = XX AND `id_shop` = XX LIMIT XX
4 queries
SELECT `id_lang` FROM `prstshp_lang`
                    WHERE `locale` = 'es-es'
                    OR `language_code` = 'es-es' LIMIT XX
4 queries
			SELECT cl.`link_rewrite`
			FROM `prstshp_category_lang` cl
			WHERE `id_lang` = XX
			 AND cl.id_shop = XX 
			AND cl.`id_category` = XX LIMIT XX
4 queries
SELECT product_attribute_shop.`price`
			FROM `prstshp_product_attribute` pa
			 INNER JOIN prstshp_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX)
			WHERE pa.`id_product_attribute` = XX LIMIT XX
4 queries
SELECT pa.`available_date` FROM `prstshp_product` p LEFT JOIN `prstshp_product_attribute` pa ON (pa.`id_product` = p.`id_product`) INNER JOIN prstshp_product_shop product_shop
        ON (product_shop.id_product = p.id_product AND product_shop.id_shop = XX) INNER JOIN prstshp_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX) WHERE p.`id_product` = XX AND pa.`id_product` = XX AND pa.`id_product_attribute` = XX LIMIT XX
4 queries
            SELECT a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
            pa.`reference`, pa.`eanXX`, pa.`isbn`, pa.`upc`, pa.`mpn`,
            pal.`available_now`, pal.`available_later`
            FROM `prstshp_attribute` a
            LEFT JOIN `prstshp_attribute_lang` al
                ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = XX)
            LEFT JOIN `prstshp_product_attribute_combination` pac
                ON (pac.`id_attribute` = a.`id_attribute`)
            LEFT JOIN `prstshp_product_attribute` pa
                ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
             INNER JOIN prstshp_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX)
            LEFT JOIN `prstshp_product_attribute_lang` pal
                ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = XX)
            LEFT JOIN `prstshp_attribute_group_lang` agl
                ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = XX)
            WHERE pa.`id_product` = XX
                AND pac.`id_product_attribute` = XX
                AND agl.`id_lang` = XX
4 queries
SELECT *
FROM `prstshp_product_attribute` a
LEFT JOIN `prstshp_product_attribute_shop` `c` ON a.`id_product_attribute` = c.`id_product_attribute` AND c.`id_shop` = XX
WHERE (a.`id_product_attribute` = XX) LIMIT XX
4 queries
SELECT *
							FROM `prstshp_product_attribute_lang`
							WHERE `id_product_attribute` = XX
3 queries
				SELECT tr.*
				FROM `prstshp_tax_rule` tr
				JOIN `prstshp_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
				WHERE trg.`active` = XX
				AND tr.`id_country` = XX
				AND tr.`id_tax_rules_group` = XX
				AND tr.`id_state` IN (XX, XX)
				AND ('XX' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
					OR (tr.`zipcode_to` = XX AND tr.`zipcode_from` IN(XX, 'XX')))
				ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
2 queries
SELECT value FROM `prstshp_configuration` WHERE `name` = "PS_MULTISHOP_FEATURE_ACTIVE" LIMIT XX
2 queries
SELECT *
FROM `prstshp_currency` a
LEFT JOIN `prstshp_currency_lang` `b` ON a.`id_currency` = b.`id_currency` AND b.`id_lang` = XX
LEFT JOIN `prstshp_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = XX
WHERE (a.`id_currency` = XX) LIMIT XX
2 queries
		SELECT `id_category`
		FROM `prstshp_category_shop`
		WHERE `id_category` = XX
		AND `id_shop` = XX LIMIT XX
2 queries
SELECT *
FROM `prstshp_category` aXX
LEFT JOIN `prstshp_category_lang` `aXX` ON (aXX.`id_category` = aXX.`id_category`)
WHERE (aXX.`nleft` < XX) AND (aXX.`nright` > XX) AND (aXX.`id_lang` = XX) AND (aXX.`id_shop` = XX)
ORDER BY aXX.`nleft` asc
2 queries
SELECT XX FROM `prstshp_cart_rule` WHERE ((date_to >= "XX-XX-XX XX:XX:XX" AND date_to <= "XX-XX-XX XX:XX:XX") OR (date_from >= "XX-XX-XX XX:XX:XX" AND date_from <= "XX-XX-XX XX:XX:XX") OR (date_from < "XX-XX-XX XX:XX:XX" AND date_to > "XX-XX-XX XX:XX:XX")) AND `id_customer` IN (XX,XX) LIMIT XX

Tables stress

156 product
152 product_shop
106 cart_product
96 image
95 specific_price
89 product_attribute_shop
80 category_lang
79 stock_available
73 image_shop
65 product_attribute
52 pack
50 product_lang
49 image_lang
48 product_group_reduction_cache
48 feature_product
48 feature_lang
48 feature_value_lang
48 feature
48 feature_shop
43 specific_price_priority
29 product_attribute_combination
28 category
28 attribute
28 attribute_lang
24 product_attribute_image
24 attribute_group
23 category_shop
13 module
10 module_shop
8 product_attribute_lang
7 lang
7 hook
7 currency
5 shop_url
5 configuration
5 currency_shop
4 shop
4 lang_shop
4 attribute_group_lang
3 country
3 hook_alias
3 currency_lang
3 category_group
3 image_type
3 tax_rule
3 tax_rules_group
2 shop_group
2 configuration_lang
2 country_lang
2 country_shop
2 hook_module
2 group
2 group_shop
2 category_product
2 manufacturer
2 cart_rule
2 psgdpr_consent
1 module_group
1 meta
1 meta_lang
1 hook_module_exceptions
1 group_lang
1 feature_flag
1 address_format
1 state
1 required_field
1 tax
1 tax_lang
1 layered_category
1 product_sale
1 layered_filter_block
1 iqit_elementor_category
1 corewhatsapp
1 psgdpr_consent_lang
1 connections
1 page_type
1 page

ObjectModel instances

Name Instances Source
Product 96 /classes/Link.php:113 (__construct) [id: 1207]
/classes/Link.php:113 (__construct) [id: 1216]
/classes/Link.php:113 (__construct) [id: 1222]
/classes/Link.php:113 (__construct) [id: 1224]
/classes/Link.php:113 (__construct) [id: 1235]
/classes/Link.php:113 (__construct) [id: 1236]
/classes/Link.php:113 (__construct) [id: 1242]
/classes/Link.php:113 (__construct) [id: 1245]
/classes/Link.php:113 (__construct) [id: 1246]
/classes/Link.php:113 (__construct) [id: 1248]
/classes/Link.php:113 (__construct) [id: 1251]
/classes/Link.php:113 (__construct) [id: 1252]
/classes/Link.php:113 (__construct) [id: 1257]
/classes/Link.php:113 (__construct) [id: 1260]
/classes/Link.php:113 (__construct) [id: 1262]
/classes/Link.php:113 (__construct) [id: 1263]
/classes/Link.php:113 (__construct) [id: 1264]
/classes/Link.php:113 (__construct) [id: 1265]
/classes/Link.php:113 (__construct) [id: 1270]
/classes/Link.php:113 (__construct) [id: 1274]
/classes/Link.php:113 (__construct) [id: 1286]
/classes/Link.php:113 (__construct) [id: 1287]
/classes/Link.php:113 (__construct) [id: 1289]
/classes/Link.php:113 (__construct) [id: 1310]
/classes/Link.php:113 (__construct) [id: 4149]
/classes/Link.php:113 (__construct) [id: 4147]
/classes/Link.php:113 (__construct) [id: 4146]
/classes/Link.php:113 (__construct) [id: 4145]
/classes/Link.php:113 (__construct) [id: 4144]
/classes/Link.php:113 (__construct) [id: 4143]
/classes/Link.php:113 (__construct) [id: 4142]
/classes/Link.php:113 (__construct) [id: 4140]
/classes/Link.php:113 (__construct) [id: 4139]
/classes/Link.php:113 (__construct) [id: 4134]
/classes/Link.php:113 (__construct) [id: 4131]
/classes/Link.php:113 (__construct) [id: 4130]
/classes/Link.php:113 (__construct) [id: 4129]
/classes/Link.php:113 (__construct) [id: 4128]
/classes/Link.php:113 (__construct) [id: 4127]
/classes/Link.php:113 (__construct) [id: 4126]
/classes/Link.php:113 (__construct) [id: 4125]
/classes/Link.php:113 (__construct) [id: 4124]
/classes/Link.php:113 (__construct) [id: 4122]
/classes/Link.php:113 (__construct) [id: 4121]
/classes/Link.php:113 (__construct) [id: 4120]
/classes/Link.php:113 (__construct) [id: 4119]
/classes/Link.php:113 (__construct) [id: 4118]
/classes/Link.php:113 (__construct) [id: 4117]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 4149]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 4147]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 4146]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 4145]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 4144]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 4143]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 4142]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 4140]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 4139]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 4134]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 4131]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 4130]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 4129]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 4128]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 4127]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 4126]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 4125]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 4124]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 4122]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 4121]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 4120]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 4119]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 4118]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 4117]
/classes/Link.php:113 (__construct) [id: 4149]
/classes/Link.php:113 (__construct) [id: 4147]
/classes/Link.php:113 (__construct) [id: 4146]
/classes/Link.php:113 (__construct) [id: 4145]
/classes/Link.php:113 (__construct) [id: 4144]
/classes/Link.php:113 (__construct) [id: 4143]
/classes/Link.php:113 (__construct) [id: 4142]
/classes/Link.php:113 (__construct) [id: 4140]
/classes/Link.php:113 (__construct) [id: 4139]
/classes/Link.php:113 (__construct) [id: 4134]
/classes/Link.php:113 (__construct) [id: 4131]
/classes/Link.php:113 (__construct) [id: 4130]
/classes/Link.php:113 (__construct) [id: 4129]
/classes/Link.php:113 (__construct) [id: 4128]
/classes/Link.php:113 (__construct) [id: 4127]
/classes/Link.php:113 (__construct) [id: 4126]
/classes/Link.php:113 (__construct) [id: 4125]
/classes/Link.php:113 (__construct) [id: 4124]
/classes/Link.php:113 (__construct) [id: 4122]
/classes/Link.php:113 (__construct) [id: 4121]
/classes/Link.php:113 (__construct) [id: 4120]
/classes/Link.php:113 (__construct) [id: 4119]
/classes/Link.php:113 (__construct) [id: 4118]
/classes/Link.php:113 (__construct) [id: 4117]
Category 24 /controllers/front/listing/CategoryController.php:76 (__construct) [id: 2]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 96]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 14]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 15]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 16]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 17]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 18]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 70]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 59]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 68]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 79]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 86]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 87]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 93]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 112]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 122]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 113]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 115]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 117]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 124]
/classes/Meta.php:379 (__construct) [id: 2]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/classes/Link.php:402 (__construct) [id: 2]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
Address 4 /classes/shop/Shop.php:486 (__construct) [id: ]
/classes/Product.php:3694 (initialize) [id: ]
/classes/Product.php:3804 (__construct) [id: ]
/classes/Product.php:5975 (__construct) [id: ]
Combination 4 /classes/Product.php:5923 (__construct) [id: 1802]
/classes/Product.php:5923 (__construct) [id: 1803]
/classes/Product.php:5923 (__construct) [id: 1806]
/classes/Product.php:5923 (__construct) [id: 1807]
Country 4 /config/config.inc.php:146 (__construct) [id: 6]
/classes/controller/FrontController.php:354 (__construct) [id: 6]
/classes/AddressFormat.php:404 (__construct) [id: 6]
/classes/controller/FrontController.php:1769 (__construct) [id: 6]
Currency 3 /src/Adapter/Currency/CurrencyDataProvider.php:101 (__construct) [id: 2]
/src/Adapter/Currency/CurrencyDataProvider.php:101 (__construct) [id: 1]
/classes/Tools.php:696 (getCurrencyInstance) [id: 2]
State 2 /classes/AddressFormat.php:404 (__construct) [id: 362]
/classes/controller/FrontController.php:1768 (__construct) [id: 362]
Language 2 /config/config.inc.php:211 (__construct) [id: 2]
/classes/Tools.php:561 (__construct) [id: 2]
Cart 2 /classes/controller/FrontController.php:467 (__construct) [id: ]
/classes/controller/FrontController.php:541 (__construct) [id: ]
Tax 2 /classes/tax/TaxRulesTaxManager.php:116 (__construct) [id: 53]
/classes/tax/TaxRulesTaxManager.php:116 (__construct) [id: 53]
Connection 1 /modules/statsdata/statsdata.php:118 (setPageConnection) [id: ]
Guest 1 /modules/statsdata/statsdata.php:82 (setNewGuest) [id: ]
IqitElementorCategory 1 /modules/iqitelementor/iqitelementor.php:784 (isJustElementor) [id: ]
Shop 1 /config/config.inc.php:117 (initialize) [id: 1]
Configuration 1 /modules/ps_accounts/src/Adapter/Configuration.php:239 (__construct) [id: 1315]
AddressFormat 1 /classes/controller/FrontController.php:1763 (generateAddress) [id: ]
Risk 1 /classes/controller/FrontController.php:1695 (__construct) [id: ]
Gender 1 /classes/controller/FrontController.php:1692 (__construct) [id: 0]
Group 1 /classes/Cart.php:249 (getCurrent) [id: 1]
Customer 1 /config/config.inc.php:264 (__construct) [id: ]
ShopGroup 1 /classes/shop/Shop.php:561 (__construct) [id: 1]
ConnectionsSource 1 /modules/statsdata/statsdata.php:119 (logHttpReferer) [id: ]

Included Files

# Filename
0 /index.php
1 /config/config.inc.php
2 /config/defines.inc.php
3 /config/autoload.php
4 /vendor/autoload.php
5 /vendor/composer/autoload_real.php
6 /vendor/composer/platform_check.php
7 /vendor/composer/ClassLoader.php
8 /vendor/composer/include_paths.php
9 /vendor/composer/autoload_static.php
10 /vendor/symfony/polyfill-php72/bootstrap.php
11 /vendor/symfony/polyfill-mbstring/bootstrap.php
12 /vendor/symfony/polyfill-mbstring/bootstrap80.php
13 /vendor/symfony/polyfill-intl-normalizer/bootstrap.php
14 /vendor/symfony/polyfill-intl-normalizer/bootstrap80.php
15 /vendor/symfony/polyfill-intl-idn/bootstrap.php
16 /vendor/symfony/deprecation-contracts/function.php
17 /vendor/ralouphie/getallheaders/src/getallheaders.php
18 /vendor/symfony/polyfill-ctype/bootstrap.php
19 /vendor/symfony/polyfill-ctype/bootstrap80.php
20 /vendor/symfony/polyfill-php80/bootstrap.php
21 /vendor/guzzlehttp/promises/src/functions_include.php
22 /vendor/guzzlehttp/promises/src/functions.php
23 /vendor/guzzlehttp/guzzle/src/functions_include.php
24 /vendor/guzzlehttp/guzzle/src/functions.php
25 /vendor/symfony/polyfill-iconv/bootstrap.php
26 /vendor/ezyang/htmlpurifier/library/HTMLPurifier.composer.php
27 /vendor/jakeasmith/http_build_url/src/http_build_url.php
28 /vendor/lcobucci/jwt/compat/class-aliases.php
29 /vendor/lcobucci/jwt/src/Token.php
30 /vendor/lcobucci/jwt/src/Signature.php
31 /vendor/lcobucci/jwt/compat/json-exception-polyfill.php
32 /vendor/lcobucci/jwt/compat/lcobucci-clock-polyfill.php
33 /vendor/swiftmailer/swiftmailer/lib/swift_required.php
34 /vendor/swiftmailer/swiftmailer/lib/classes/Swift.php
35 /vendor/symfony/polyfill-intl-icu/bootstrap.php
36 /vendor/symfony/polyfill-php73/bootstrap.php
37 /vendor/symfony/polyfill-php81/bootstrap.php
38 /vendor/api-platform/core/src/deprecation.php
39 /vendor/api-platform/core/src/Api/FilterInterface.php
40 /vendor/api-platform/core/src/Api/ResourceClassResolverInterface.php
41 /vendor/api-platform/core/src/deprecated_interfaces.php
42 /vendor/api-platform/core/src/Metadata/Property/Factory/PropertyNameCollectionFactoryInterface.php
43 /vendor/api-platform/core/src/Metadata/Resource/Factory/ResourceNameCollectionFactoryInterface.php
44 /vendor/api-platform/core/src/Metadata/Extractor/ResourceExtractorInterface.php
45 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/DateFilterInterface.php
46 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/ExistsFilterInterface.php
47 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/OrderFilterInterface.php
48 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/RangeFilterInterface.php
49 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/SearchFilterInterface.php
50 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationCollectionExtensionInterface.php
51 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationItemExtensionInterface.php
52 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultCollectionExtensionInterface.php
53 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultItemExtensionInterface.php
54 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Filter/FilterInterface.php
55 /vendor/api-platform/core/src/Doctrine/Orm/QueryAwareInterface.php
56 /vendor/api-platform/core/src/Doctrine/Orm/Util/QueryNameGeneratorInterface.php
57 /vendor/api-platform/core/src/Elasticsearch/Metadata/Document/Factory/DocumentMetadataFactoryInterface.php
58 /vendor/api-platform/core/src/Symfony/Validator/ValidationGroupsGeneratorInterface.php
59 /vendor/api-platform/core/src/Symfony/Validator/Exception/ConstraintViolationListAwareExceptionInterface.php
60 /vendor/api-platform/core/src/Exception/ExceptionInterface.php
61 /vendor/api-platform/core/src/Core/Bridge/Symfony/Validator/Metadata/Property/Restriction/PropertySchemaRestrictionMetadataInterface.php
62 /vendor/api-platform/core/src/State/Pagination/PaginatorInterface.php
63 /vendor/api-platform/core/src/State/Pagination/PartialPaginatorInterface.php
64 /vendor/api-platform/core/src/Documentation/DocumentationInterface.php
65 /vendor/api-platform/core/src/JsonLd/AnonymousContextBuilderInterface.php
66 /vendor/api-platform/core/src/JsonLd/ContextBuilderInterface.php
67 /vendor/api-platform/core/src/Core/JsonSchema/SchemaFactoryInterface.php
68 /vendor/api-platform/core/src/JsonSchema/TypeFactoryInterface.php
69 /vendor/api-platform/core/src/OpenApi/Factory/OpenApiFactoryInterface.php
70 /vendor/api-platform/core/src/PathResolver/OperationPathResolverInterface.php
71 /vendor/api-platform/core/src/Symfony/Security/ResourceAccessCheckerInterface.php
72 /vendor/api-platform/core/src/Serializer/Filter/FilterInterface.php
73 /vendor/api-platform/core/src/Serializer/SerializerContextBuilderInterface.php
74 /vendor/api-platform/core/src/Validator/ValidatorInterface.php
75 /vendor/api-platform/core/src/Api/UrlGeneratorInterface.php
76 /vendor/api-platform/core/src/GraphQl/ExecutorInterface.php
77 /vendor/api-platform/core/src/GraphQl/Error/ErrorHandlerInterface.php
78 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ValidateStageInterface.php
79 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ReadStageInterface.php
80 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityPostDenormalizeStageInterface.php
81 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityStageInterface.php
82 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/WriteStageInterface.php
83 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SerializeStageInterface.php
84 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/DeserializeStageInterface.php
85 /vendor/api-platform/core/src/GraphQl/Resolver/QueryItemResolverInterface.php
86 /vendor/api-platform/core/src/GraphQl/Resolver/QueryCollectionResolverInterface.php
87 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Factory/ResolverFactoryInterface.php
88 /vendor/api-platform/core/src/GraphQl/Resolver/MutationResolverInterface.php
89 /vendor/api-platform/core/src/Core/GraphQl/Subscription/MercureSubscriptionIriGeneratorInterface.php
90 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionIdentifierGeneratorInterface.php
91 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionManagerInterface.php
92 /vendor/api-platform/core/src/Core/GraphQl/Serializer/SerializerContextBuilderInterface.php
93 /vendor/api-platform/core/src/GraphQl/Type/TypesFactoryInterface.php
94 /vendor/api-platform/core/src/GraphQl/Type/Definition/TypeInterface.php
95 /vendor/api-platform/core/src/GraphQl/Type/TypesContainerInterface.php
96 /vendor/psr/container/src/ContainerInterface.php
97 /vendor/api-platform/core/src/Operation/PathSegmentNameGeneratorInterface.php
98 /vendor/ircmaxell/password-compat/lib/password.php
99 /vendor/martinlindhe/php-mb-helpers/src/mb_helpers.php
100 /vendor/prestashop/laminas-code-lts/polyfill/ReflectionEnumPolyfill.php
101 /src/Core/Version.php
102 /config/alias.php
103 /vendor/prestashop/autoload/src/PrestashopAutoload.php
104 /vendor/prestashop/autoload/src/LegacyClassLoader.php
105 /vendor/symfony/symfony/src/Symfony/Component/Filesystem/Filesystem.php
106 /vendor/prestashop/autoload/src/Autoloader.php
107 /config/bootstrap.php
108 /src/Core/ContainerBuilder.php
109 /src/Core/Foundation/IoC/Container.php
110 /src/Adapter/ServiceLocator.php
111 /var/cache/prod/appParameters.php
114 /var/cache/prod/class_index.php
115 /classes/controller/Controller.php
117 /classes/ObjectModel.php
118 /src/Core/Foundation/Database/EntityInterface.php
120 /classes/db/Db.php
122 /classes/Hook.php
124 /classes/module/Module.php
125 /src/Core/Module/Legacy/ModuleInterface.php
127 /classes/Tools.php
128 /classes/Context.php
129 /classes/shop/Shop.php
130 /src/Core/Security/PasswordGenerator.php
131 /classes/db/DbPDO.php
132 /classes/AddressFormat.php
133 /classes/Configuration.php
134 /classes/Validate.php
135 /classes/cache/Cache.php
136 /src/Adapter/EntityMapper.php
137 /classes/db/DbQuery.php
138 /src/Core/Addon/Theme/ThemeManagerBuilder.php
139 /vendor/psr/log/Psr/Log/NullLogger.php
140 /vendor/psr/log/Psr/Log/AbstractLogger.php
141 /vendor/psr/log/Psr/Log/LoggerInterface.php
142 /src/Adapter/Configuration.php
143 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ParameterBag.php
144 /src/Core/Domain/Configuration/ShopConfigurationInterface.php
145 /src/Core/ConfigurationInterface.php
146 /src/Core/Addon/Theme/ThemeRepository.php
147 /src/Core/Addon/AddonRepositoryInterface.php
148 /src/Core/Domain/Shop/ValueObject/ShopConstraint.php
149 /src/Core/Addon/Theme/Theme.php
150 /src/Core/Addon/AddonInterface.php
151 /src/Core/Util/ArrayFinder.php
152 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccess.php
153 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorBuilder.php
154 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessor.php
155 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorInterface.php
156 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPath.php
157 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPathInterface.php
158 /config/defines_uri.inc.php
159 /classes/Language.php
160 /src/Core/Language/LanguageInterface.php
161 /classes/Country.php
162 /classes/PrestaShopCollection.php
163 /classes/shop/ShopGroup.php
164 /classes/Cookie.php
165 /classes/PhpEncryption.php
166 /classes/PhpEncryptionEngine.php
167 /vendor/defuse/php-encryption/src/Key.php
168 /vendor/defuse/php-encryption/src/Encoding.php
169 /vendor/defuse/php-encryption/src/Core.php
170 /src/Core/Session/SessionHandler.php
171 /src/Core/Session/SessionHandlerInterface.php
172 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Session.php
173 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBag.php
174 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBagInterface.php
175 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagInterface.php
176 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBag.php
177 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBagInterface.php
178 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagProxy.php
179 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionInterface.php
180 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/PhpBridgeSessionStorage.php
181 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/NativeSessionStorage.php
182 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/MetadataBag.php
183 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/StrictSessionHandler.php
184 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/AbstractSessionHandler.php
185 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/SessionHandlerProxy.php
186 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/AbstractProxy.php
187 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/SessionStorageInterface.php
188 /config/smarty.config.inc.php
189 /vendor/smarty/smarty/libs/Smarty.class.php
190 /vendor/smarty/smarty/libs/functions.php
191 /vendor/smarty/smarty/libs/Autoloader.php
192 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_data.php
193 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_extension_handler.php
194 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php
195 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php
196 /vendor/smarty/smarty/libs/sysplugins/smarty_resource.php
197 /vendor/smarty/smarty/libs/sysplugins/smarty_variable.php
198 /vendor/smarty/smarty/libs/sysplugins/smarty_template_source.php
199 /vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php
200 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_resource_file.php
201 /config/smartyfront.config.inc.php
202 /classes/Smarty/SmartyResourceModule.php
203 /vendor/smarty/smarty/libs/sysplugins/smarty_resource_custom.php
204 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerresource.php
205 /classes/Smarty/SmartyResourceParent.php
206 /classes/Smarty/SmartyLazyRegister.php
207 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerplugin.php
208 /vendor/smarty/smarty/libs/plugins/modifier.truncate.php
209 /classes/Customer.php
210 /classes/Group.php
211 /classes/Link.php
212 /classes/shop/ShopUrl.php
213 /classes/Dispatcher.php
214 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Request.php
215 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeader.php
216 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeaderItem.php
217 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/FileBag.php
218 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderBag.php
219 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderUtils.php
220 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ServerBag.php
221 /src/Adapter/SymfonyContainer.php
222 /vendor/mobiledetect/mobiledetectlib/Mobile_Detect.php
223 /config/db_slave_server.inc.php
224 /src/Adapter/ContainerBuilder.php
225 /src/Adapter/Environment.php
226 /src/Core/EnvironmentInterface.php
227 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCache.php
228 /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerConfigCache.php
229 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheInterface.php
230 /vendor/symfony/symfony/src/Symfony/Component/Cache/DoctrineProvider.php
231 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/CacheProvider.php
232 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Cache.php
233 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/FlushableCache.php
234 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/ClearableCache.php
235 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiOperationCache.php
236 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiGetCache.php
237 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiDeleteCache.php
238 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiPutCache.php
239 /vendor/symfony/symfony/src/Symfony/Component/Cache/PruneableInterface.php
240 /vendor/symfony/symfony/src/Symfony/Component/Cache/ResettableInterface.php
241 /vendor/symfony/contracts/Service/ResetInterface.php
242 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/ArrayAdapter.php
243 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ArrayTrait.php
244 /vendor/psr/log/Psr/Log/LoggerAwareTrait.php
245 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AdapterInterface.php
246 /vendor/symfony/symfony/src/Symfony/Component/Cache/CacheItem.php
247 /vendor/symfony/contracts/Cache/ItemInterface.php
248 /vendor/psr/cache/src/CacheItemInterface.php
249 /vendor/psr/cache/src/CacheItemPoolInterface.php
250 /vendor/symfony/contracts/Cache/CacheInterface.php
251 /vendor/psr/log/Psr/Log/LoggerAwareInterface.php
252 /vendor/doctrine/orm/lib/Doctrine/ORM/Tools/Setup.php
253 /vendor/doctrine/deprecations/lib/Doctrine/Deprecations/Deprecation.php
254 /vendor/doctrine/orm/lib/Doctrine/ORM/Configuration.php
255 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Configuration.php
256 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/CacheAdapter.php
257 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/DoctrineProvider.php
258 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationReader.php
259 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Reader.php
260 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationRegistry.php
261 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/DoctrineAnnotations.php
262 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Annotation.php
263 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Entity.php
264 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embeddable.php
265 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embedded.php
266 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/MappedSuperclass.php
267 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/InheritanceType.php
268 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorColumn.php
269 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorMap.php
270 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Id.php
271 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/GeneratedValue.php
272 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Version.php
273 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumn.php
274 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumns.php
275 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Column.php
276 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToOne.php
277 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToMany.php
278 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToOne.php
279 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToMany.php
280 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Table.php
281 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/UniqueConstraint.php
282 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Index.php
283 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinTable.php
284 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SequenceGenerator.php
285 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/CustomIdGenerator.php
286 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ChangeTrackingPolicy.php
287 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OrderBy.php
288 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQueries.php
289 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQuery.php
290 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/HasLifecycleCallbacks.php
291 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PrePersist.php
292 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostPersist.php
293 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreUpdate.php
294 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostUpdate.php
295 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreRemove.php
296 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostRemove.php
297 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostLoad.php
298 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreFlush.php
299 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/FieldResult.php
300 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ColumnResult.php
301 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityResult.php
302 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQuery.php
303 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQueries.php
304 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMapping.php
305 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMappings.php
306 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverride.php
307 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverrides.php
308 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverride.php
309 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverrides.php
310 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityListeners.php
311 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Cache.php
312 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/SimpleAnnotationReader.php
313 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocParser.php
314 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocLexer.php
315 /vendor/doctrine/lexer/lib/Doctrine/Common/Lexer/AbstractLexer.php
316 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Target.php
317 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/AnnotationDriver.php
318 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/CompatibilityAnnotationDriver.php
319 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/MappingDriver.php
320 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/ColocatedMappingDriver.php
321 /var/cache/prod/FrontContainer.php
322 /src/Adapter/Container/LegacyContainer.php
323 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Container.php
324 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/RewindableGenerator.php
325 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/ServiceLocator.php
326 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ServiceLocator.php
327 /vendor/symfony/contracts/Service/ServiceLocatorTrait.php
328 /vendor/psr/container/src/ContainerExceptionInterface.php
329 /vendor/psr/container/src/NotFoundExceptionInterface.php
330 /vendor/symfony/contracts/Service/ServiceProviderInterface.php
331 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ResettableContainerInterface.php
332 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ContainerInterface.php
333 /src/Adapter/Container/LegacyContainerInterface.php
334 /modules/blockwishlist/vendor/autoload.php
335 /modules/blockwishlist/vendor/composer/autoload_real.php
336 /modules/blockwishlist/vendor/composer/autoload_static.php
337 /modules/contactform/vendor/autoload.php
338 /modules/contactform/vendor/composer/autoload_real.php
339 /modules/contactform/vendor/composer/autoload_static.php
340 /modules/dashactivity/vendor/autoload.php
341 /modules/dashactivity/vendor/composer/autoload_real.php
342 /modules/dashactivity/vendor/composer/autoload_static.php
343 /modules/dashtrends/vendor/autoload.php
344 /modules/dashtrends/vendor/composer/autoload_real.php
345 /modules/dashtrends/vendor/composer/autoload_static.php
346 /modules/dashgoals/vendor/autoload.php
347 /modules/dashgoals/vendor/composer/autoload_real.php
348 /modules/dashgoals/vendor/composer/autoload_static.php
349 /modules/dashproducts/vendor/autoload.php
350 /modules/dashproducts/vendor/composer/autoload_real.php
351 /modules/dashproducts/vendor/composer/platform_check.php
352 /modules/dashproducts/vendor/composer/autoload_static.php
353 /modules/graphnvd3/vendor/autoload.php
354 /modules/graphnvd3/vendor/composer/autoload_real.php
355 /modules/graphnvd3/vendor/composer/autoload_static.php
356 /modules/gridhtml/vendor/autoload.php
357 /modules/gridhtml/vendor/composer/autoload_real.php
358 /modules/gridhtml/vendor/composer/autoload_static.php
359 /modules/gsitemap/vendor/autoload.php
360 /modules/gsitemap/vendor/composer/autoload_real.php
361 /modules/gsitemap/vendor/composer/platform_check.php
362 /modules/gsitemap/vendor/composer/autoload_static.php
363 /modules/pagesnotfound/vendor/autoload.php
364 /modules/pagesnotfound/vendor/composer/autoload_real.php
365 /modules/pagesnotfound/vendor/composer/platform_check.php
366 /modules/pagesnotfound/vendor/composer/autoload_static.php
367 /modules/productcomments/vendor/autoload.php
368 /modules/productcomments/vendor/composer/autoload_real.php
369 /modules/productcomments/vendor/composer/platform_check.php
370 /modules/productcomments/vendor/composer/autoload_static.php
371 /modules/ps_checkpayment/vendor/autoload.php
372 /modules/ps_checkpayment/vendor/composer/autoload_real.php
373 /modules/ps_checkpayment/vendor/composer/autoload_static.php
374 /modules/ps_contactinfo/vendor/autoload.php
375 /modules/ps_contactinfo/vendor/composer/autoload_real.php
376 /modules/ps_contactinfo/vendor/composer/autoload_static.php
377 /modules/ps_crossselling/vendor/autoload.php
378 /modules/ps_crossselling/vendor/composer/autoload_real.php
379 /modules/ps_crossselling/vendor/composer/platform_check.php
380 /modules/ps_crossselling/vendor/composer/autoload_static.php
381 /modules/ps_currencyselector/vendor/autoload.php
382 /modules/ps_currencyselector/vendor/composer/autoload_real.php
383 /modules/ps_currencyselector/vendor/composer/autoload_static.php
384 /modules/ps_customeraccountlinks/vendor/autoload.php
385 /modules/ps_customeraccountlinks/vendor/composer/autoload_real.php
386 /modules/ps_customeraccountlinks/vendor/composer/autoload_static.php
387 /modules/ps_customtext/vendor/autoload.php
388 /modules/ps_customtext/vendor/composer/autoload_real.php
389 /modules/ps_customtext/vendor/composer/platform_check.php
390 /modules/ps_customtext/vendor/composer/autoload_static.php
391 /modules/ps_dataprivacy/vendor/autoload.php
392 /modules/ps_dataprivacy/vendor/composer/autoload_real.php
393 /modules/ps_dataprivacy/vendor/composer/autoload_static.php
394 /modules/ps_emailsubscription/vendor/autoload.php
395 /modules/ps_emailsubscription/vendor/composer/autoload_real.php
396 /modules/ps_emailsubscription/vendor/composer/platform_check.php
397 /modules/ps_emailsubscription/vendor/composer/autoload_static.php
398 /modules/ps_faviconnotificationbo/vendor/autoload.php
399 /modules/ps_faviconnotificationbo/vendor/composer/autoload_real.php
400 /modules/ps_faviconnotificationbo/vendor/composer/platform_check.php
401 /modules/ps_faviconnotificationbo/vendor/composer/autoload_static.php
402 /modules/ps_featuredproducts/vendor/autoload.php
403 /modules/ps_featuredproducts/vendor/composer/autoload_real.php
404 /modules/ps_featuredproducts/vendor/composer/platform_check.php
405 /modules/ps_featuredproducts/vendor/composer/autoload_static.php
406 /modules/ps_imageslider/vendor/autoload.php
407 /modules/ps_imageslider/vendor/composer/autoload_real.php
408 /modules/ps_imageslider/vendor/composer/platform_check.php
409 /modules/ps_imageslider/vendor/composer/autoload_static.php
410 /modules/ps_languageselector/vendor/autoload.php
411 /modules/ps_languageselector/vendor/composer/autoload_real.php
412 /modules/ps_languageselector/vendor/composer/autoload_static.php
413 /modules/ps_linklist/vendor/autoload.php
414 /modules/ps_linklist/vendor/composer/autoload_real.php
415 /modules/ps_linklist/vendor/composer/autoload_static.php
416 /modules/ps_mainmenu/vendor/autoload.php
417 /modules/ps_mainmenu/vendor/composer/autoload_real.php
418 /modules/ps_mainmenu/vendor/composer/platform_check.php
419 /modules/ps_mainmenu/vendor/composer/autoload_static.php
420 /modules/ps_searchbar/vendor/autoload.php
421 /modules/ps_searchbar/vendor/composer/autoload_real.php
422 /modules/ps_searchbar/vendor/composer/autoload_static.php
423 /modules/ps_sharebuttons/vendor/autoload.php
424 /modules/ps_sharebuttons/vendor/composer/autoload_real.php
425 /modules/ps_sharebuttons/vendor/composer/autoload_static.php
426 /modules/ps_shoppingcart/vendor/autoload.php
427 /modules/ps_shoppingcart/vendor/composer/autoload_real.php
428 /modules/ps_shoppingcart/vendor/composer/autoload_static.php
429 /modules/ps_socialfollow/vendor/autoload.php
430 /modules/ps_socialfollow/vendor/composer/autoload_real.php
431 /modules/ps_socialfollow/vendor/composer/platform_check.php
432 /modules/ps_socialfollow/vendor/composer/autoload_static.php
433 /modules/ps_themecusto/vendor/autoload.php
434 /modules/ps_themecusto/vendor/composer/autoload_real.php
435 /modules/ps_themecusto/vendor/composer/autoload_static.php
436 /modules/ps_wirepayment/vendor/autoload.php
437 /modules/ps_wirepayment/vendor/composer/autoload_real.php
438 /modules/ps_wirepayment/vendor/composer/platform_check.php
439 /modules/ps_wirepayment/vendor/composer/autoload_static.php
440 /modules/statsbestcategories/vendor/autoload.php
441 /modules/statsbestcategories/vendor/composer/autoload_real.php
442 /modules/statsbestcategories/vendor/composer/platform_check.php
443 /modules/statsbestcategories/vendor/composer/autoload_static.php
444 /modules/statsbestcustomers/vendor/autoload.php
445 /modules/statsbestcustomers/vendor/composer/autoload_real.php
446 /modules/statsbestcustomers/vendor/composer/platform_check.php
447 /modules/statsbestcustomers/vendor/composer/autoload_static.php
448 /modules/statsbestproducts/vendor/autoload.php
449 /modules/statsbestproducts/vendor/composer/autoload_real.php
450 /modules/statsbestproducts/vendor/composer/platform_check.php
451 /modules/statsbestproducts/vendor/composer/autoload_static.php
452 /modules/statsbestsuppliers/vendor/autoload.php
453 /modules/statsbestsuppliers/vendor/composer/autoload_real.php
454 /modules/statsbestsuppliers/vendor/composer/platform_check.php
455 /modules/statsbestsuppliers/vendor/composer/autoload_static.php
456 /modules/statsbestvouchers/vendor/autoload.php
457 /modules/statsbestvouchers/vendor/composer/autoload_real.php
458 /modules/statsbestvouchers/vendor/composer/platform_check.php
459 /modules/statsbestvouchers/vendor/composer/autoload_static.php
460 /modules/statscarrier/vendor/autoload.php
461 /modules/statscarrier/vendor/composer/autoload_real.php
462 /modules/statscarrier/vendor/composer/platform_check.php
463 /modules/statscarrier/vendor/composer/autoload_static.php
464 /modules/statscatalog/vendor/autoload.php
465 /modules/statscatalog/vendor/composer/autoload_real.php
466 /modules/statscatalog/vendor/composer/platform_check.php
467 /modules/statscatalog/vendor/composer/autoload_static.php
468 /modules/statscheckup/vendor/autoload.php
469 /modules/statscheckup/vendor/composer/autoload_real.php
470 /modules/statscheckup/vendor/composer/platform_check.php
471 /modules/statscheckup/vendor/composer/autoload_static.php
472 /modules/statsdata/vendor/autoload.php
473 /modules/statsdata/vendor/composer/autoload_real.php
474 /modules/statsdata/vendor/composer/platform_check.php
475 /modules/statsdata/vendor/composer/autoload_static.php
476 /modules/statsforecast/vendor/autoload.php
477 /modules/statsforecast/vendor/composer/autoload_real.php
478 /modules/statsforecast/vendor/composer/platform_check.php
479 /modules/statsforecast/vendor/composer/autoload_static.php
480 /modules/statsnewsletter/vendor/autoload.php
481 /modules/statsnewsletter/vendor/composer/autoload_real.php
482 /modules/statsnewsletter/vendor/composer/platform_check.php
483 /modules/statsnewsletter/vendor/composer/autoload_static.php
484 /modules/statspersonalinfos/vendor/autoload.php
485 /modules/statspersonalinfos/vendor/composer/autoload_real.php
486 /modules/statspersonalinfos/vendor/composer/platform_check.php
487 /modules/statspersonalinfos/vendor/composer/autoload_static.php
488 /modules/statsproduct/vendor/autoload.php
489 /modules/statsproduct/vendor/composer/autoload_real.php
490 /modules/statsproduct/vendor/composer/platform_check.php
491 /modules/statsproduct/vendor/composer/autoload_static.php
492 /modules/statsregistrations/vendor/autoload.php
493 /modules/statsregistrations/vendor/composer/autoload_real.php
494 /modules/statsregistrations/vendor/composer/platform_check.php
495 /modules/statsregistrations/vendor/composer/autoload_static.php
496 /modules/statssales/vendor/autoload.php
497 /modules/statssales/vendor/composer/autoload_real.php
498 /modules/statssales/vendor/composer/platform_check.php
499 /modules/statssales/vendor/composer/autoload_static.php
500 /modules/statssearch/vendor/autoload.php
501 /modules/statssearch/vendor/composer/autoload_real.php
502 /modules/statssearch/vendor/composer/platform_check.php
503 /modules/statssearch/vendor/composer/autoload_static.php
504 /modules/statsstock/vendor/autoload.php
505 /modules/statsstock/vendor/composer/autoload_real.php
506 /modules/statsstock/vendor/composer/platform_check.php
507 /modules/statsstock/vendor/composer/autoload_static.php
508 /modules/psgdpr/vendor/autoload.php
509 /modules/psgdpr/vendor/composer/autoload_real.php
510 /modules/psgdpr/vendor/composer/autoload_static.php
511 /modules/ps_metrics/vendor/autoload.php
512 /modules/ps_metrics/vendor/composer/autoload_real.php
513 /modules/ps_metrics/vendor/composer/autoload_static.php
514 /modules/ps_metrics/vendor/symfony/polyfill-php80/bootstrap.php
515 /modules/ps_metrics/vendor/symfony/deprecation-contracts/function.php
516 /modules/ps_metrics/vendor/symfony/polyfill-mbstring/bootstrap.php
517 /modules/ps_metrics/vendor/symfony/polyfill-mbstring/bootstrap80.php
518 /modules/ps_metrics/vendor/symfony/polyfill-ctype/bootstrap.php
519 /modules/ps_metrics/vendor/symfony/polyfill-ctype/bootstrap80.php
520 /modules/ps_metrics/vendor/symfony/polyfill-php73/bootstrap.php
521 /modules/ps_metrics/vendor/symfony/polyfill-intl-grapheme/bootstrap.php
522 /modules/ps_metrics/vendor/symfony/polyfill-intl-normalizer/bootstrap.php
523 /modules/ps_metrics/vendor/symfony/polyfill-intl-normalizer/bootstrap80.php
524 /modules/ps_metrics/vendor/symfony/string/Resources/functions.php
525 /modules/ps_metrics/vendor/clue/stream-filter/src/functions_include.php
526 /modules/ps_metrics/vendor/clue/stream-filter/src/functions.php
527 /modules/ps_metrics/vendor/ralouphie/getallheaders/src/getallheaders.php
528 /modules/ps_metrics/vendor/guzzlehttp/psr7/src/functions_include.php
529 /modules/ps_metrics/vendor/guzzlehttp/psr7/src/functions.php
530 /modules/ps_metrics/vendor/php-http/message/src/filters.php
531 /modules/ps_metrics/vendor/symfony/polyfill-php81/bootstrap.php
532 /modules/ps_metrics/vendor/phpstan/phpstan/bootstrap.php
533 /modules/ps_metrics/vendor/segmentio/analytics-php/lib/Segment.php
534 /modules/ps_metrics/vendor/segmentio/analytics-php/lib/Segment/Client.php
535 /modules/ps_metrics/vendor/segmentio/analytics-php/lib/Segment/Consumer.php
536 /modules/ps_metrics/vendor/segmentio/analytics-php/lib/Segment/QueueConsumer.php
537 /modules/ps_metrics/vendor/segmentio/analytics-php/lib/Segment/Consumer/File.php
538 /modules/ps_metrics/vendor/segmentio/analytics-php/lib/Segment/Consumer/ForkCurl.php
539 /modules/ps_metrics/vendor/segmentio/analytics-php/lib/Segment/Consumer/Socket.php
540 /modules/ps_facebook/vendor/autoload.php
541 /modules/ps_facebook/vendor/composer/autoload_real.php
542 /modules/ps_facebook/vendor/composer/autoload_static.php
543 /modules/ps_facebook/vendor/segmentio/analytics-php/lib/Segment.php
544 /modules/ps_facebook/vendor/segmentio/analytics-php/lib/Segment/Client.php
545 /modules/ps_facebook/vendor/segmentio/analytics-php/lib/Segment/Consumer.php
546 /modules/ps_facebook/vendor/segmentio/analytics-php/lib/Segment/QueueConsumer.php
547 /modules/ps_facebook/vendor/segmentio/analytics-php/lib/Segment/Consumer/File.php
548 /modules/ps_facebook/vendor/segmentio/analytics-php/lib/Segment/Consumer/ForkCurl.php
549 /modules/ps_facebook/vendor/segmentio/analytics-php/lib/Segment/Consumer/LibCurl.php
550 /modules/ps_facebook/vendor/segmentio/analytics-php/lib/Segment/Consumer/Socket.php
551 /modules/ps_facebook/vendor/segmentio/analytics-php/lib/Segment/Version.php
552 /modules/psxmarketingwithgoogle/vendor/autoload.php
553 /modules/psxmarketingwithgoogle/vendor/composer/autoload_real.php
554 /modules/psxmarketingwithgoogle/vendor/composer/autoload_static.php
555 /modules/blockreassurance/vendor/autoload.php
556 /modules/blockreassurance/vendor/composer/autoload_real.php
557 /modules/blockreassurance/vendor/composer/autoload_static.php
558 /modules/ps_facetedsearch/vendor/autoload.php
559 /modules/ps_facetedsearch/vendor/composer/autoload_real.php
560 /modules/ps_facetedsearch/vendor/composer/platform_check.php
561 /modules/ps_facetedsearch/vendor/composer/autoload_static.php
562 /modules/ps_emailalerts/vendor/autoload.php
563 /modules/ps_emailalerts/vendor/composer/autoload_real.php
564 /modules/ps_emailalerts/vendor/composer/autoload_static.php
565 /modules/ps_categorytree/vendor/autoload.php
566 /modules/ps_categorytree/vendor/composer/autoload_real.php
567 /modules/ps_categorytree/vendor/composer/platform_check.php
568 /modules/ps_categorytree/vendor/composer/autoload_static.php
569 /modules/ps_distributionapiclient/vendor/autoload.php
570 /modules/ps_distributionapiclient/vendor/composer/autoload_real.php
571 /modules/ps_distributionapiclient/vendor/composer/platform_check.php
572 /modules/ps_distributionapiclient/vendor/composer/autoload_static.php
573 /modules/ps_distributionapiclient/vendor/symfony/polyfill-intl-grapheme/bootstrap.php
574 /modules/ps_distributionapiclient/vendor/symfony/string/Resources/functions.php
575 /src/Core/Hook/HookModuleFilter.php
576 /src/Core/Hook/HookModuleFilterInterface.php
577 /controllers/front/listing/CategoryController.php
578 /classes/controller/ProductListingFrontController.php
579 /classes/controller/ProductPresentingFrontController.php
580 /classes/controller/FrontController.php
581 /src/PrestaShopBundle/Translation/TranslatorComponent.php
582 /vendor/symfony/symfony/src/Symfony/Component/Translation/Translator.php
583 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorInterface.php
584 /vendor/symfony/contracts/Translation/LocaleAwareInterface.php
585 /vendor/symfony/contracts/Translation/TranslatorInterface.php
586 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorBagInterface.php
587 /src/PrestaShopBundle/Translation/PrestaShopTranslatorTrait.php
588 /src/PrestaShopBundle/Translation/TranslatorLanguageTrait.php
589 /src/PrestaShopBundle/Translation/TranslatorInterface.php
590 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatter.php
591 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatter.php
592 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatterInterface.php
593 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatterInterface.php
594 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/ChoiceMessageFormatterInterface.php
595 /vendor/symfony/symfony/src/Symfony/Component/Translation/IdentityTranslator.php
596 /vendor/symfony/contracts/Translation/TranslatorTrait.php
597 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactory.php
598 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactoryInterface.php
599 /var/cache/prod/translations/catalogue.es-ES.NXhscRe.php
600 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogue.php
601 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogueInterface.php
602 /vendor/symfony/symfony/src/Symfony/Component/Translation/MetadataAwareInterface.php
603 /src/Adapter/Presenter/Object/ObjectPresenter.php
604 /src/Adapter/Presenter/PresenterInterface.php
605 /src/Adapter/Presenter/Cart/CartPresenter.php
606 /src/Adapter/Image/ImageRetriever.php
607 /classes/tax/TaxConfiguration.php
608 /classes/Smarty/TemplateFinder.php
609 /classes/assets/StylesheetManager.php
610 /classes/assets/AbstractAssetManager.php
611 /src/Adapter/Assets/AssetUrlGeneratorTrait.php
612 /classes/assets/JavascriptManager.php
613 /classes/assets/CccReducer.php
614 /modules/iqitthemeeditor/iqitthemeeditor.php
615 /modules/iqitthemeeditor/src/IqitSmartyModifiers.php
616 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_createdata.php
617 /vendor/smarty/smarty/libs/sysplugins/smarty_data.php
618 /classes/Translate.php
619 /modules/iqitthemeeditor/translations/es.php
620 /classes/Category.php
621 /classes/webservice/WebserviceRequest.php
622 /src/Core/Localization/Locale/Repository.php
623 /src/Core/Localization/Locale/RepositoryInterface.php
624 /src/Core/Localization/CLDR/LocaleRepository.php
625 /src/Core/Localization/CLDR/LocaleDataSource.php
626 /src/Core/Localization/CLDR/DataLayer/LocaleCache.php
627 /src/Core/Data/Layer/AbstractDataLayer.php
628 /src/Core/Localization/CLDR/LocaleDataLayerInterface.php
629 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/FilesystemAdapter.php
630 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AbstractAdapter.php
631 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractAdapterTrait.php
632 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractTrait.php
633 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ContractsTrait.php
634 /vendor/symfony/contracts/Cache/CacheTrait.php
635 /vendor/psr/cache/src/InvalidArgumentException.php
636 /vendor/psr/cache/src/CacheException.php
637 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemTrait.php
638 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemCommonTrait.php
639 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/DefaultMarshaller.php
640 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/MarshallerInterface.php
641 /src/Core/Localization/CLDR/DataLayer/LocaleReference.php
642 /src/Core/Localization/CLDR/Reader.php
643 /src/Core/Localization/CLDR/ReaderInterface.php
644 /src/Core/Localization/Currency/Repository.php
645 /src/Core/Localization/Currency/RepositoryInterface.php
646 /src/Core/Localization/Currency/CurrencyDataSource.php
647 /src/Core/Localization/Currency/DataSourceInterface.php
648 /src/Core/Localization/Currency/DataLayer/CurrencyCache.php
649 /src/Core/Localization/Currency/CurrencyDataLayerInterface.php
650 /src/Core/Localization/Currency/DataLayer/CurrencyDatabase.php
651 /src/Adapter/Currency/CurrencyDataProvider.php
652 /src/Core/Currency/CurrencyDataProviderInterface.php
653 /src/Adapter/LegacyContext.php
654 /src/Adapter/Tools.php
655 /src/Core/Localization/Currency/DataLayer/CurrencyReference.php
656 /src/Core/Localization/Currency/DataLayer/CurrencyInstalled.php
657 /vendor/prestashop/decimal/src/Operation/Rounding.php
658 /src/Core/Localization/Locale.php
659 /src/Core/Localization/LocaleInterface.php
660 /src/Core/Localization/Specification/Price.php
661 /src/Core/Localization/Specification/Number.php
662 /src/Core/Localization/Specification/NumberInterface.php
663 /src/Core/Localization/Specification/Factory.php
664 /src/Core/Localization/CLDR/LocaleData.php
665 /src/Core/Localization/CLDR/NumberSymbolsData.php
666 /src/Core/Localization/CLDR/CurrencyData.php
667 /src/Core/Localization/CLDR/Locale.php
668 /src/Core/Localization/CLDR/LocaleInterface.php
669 /src/Core/Localization/Specification/NumberSymbolList.php
670 /classes/Currency.php
671 /src/Core/Localization/Currency/LocalizedCurrencyId.php
672 /src/Core/Localization/Currency/CurrencyData.php
673 /src/Core/Localization/Currency/CurrencyCollection.php
674 /src/Core/Localization/Currency.php
675 /src/Core/Localization/CurrencyInterface.php
676 /src/Core/Localization/Specification/NumberCollection.php
677 /src/Core/Localization/Number/Formatter.php
678 /classes/Cart.php
679 /src/Adapter/AddressFactory.php
680 /classes/CartRule.php
681 /classes/Product.php
682 /src/Core/Domain/Product/ValueObject/RedirectType.php
683 /src/Core/Util/DateTime/DateTime.php
684 /src/Core/Domain/Product/Stock/ValueObject/OutOfStockType.php
685 /src/Core/Domain/Product/Pack/ValueObject/PackStockType.php
686 /src/Core/Domain/Product/ValueObject/ProductType.php
687 /src/Core/Domain/Product/ValueObject/Reference.php
688 /src/Core/Domain/Product/ValueObject/Ean13.php
689 /src/Core/Domain/Product/ValueObject/Isbn.php
690 /src/Core/Domain/Product/ValueObject/Upc.php
691 /src/Core/Domain/Product/ProductSettings.php
692 /src/Core/Image/ImageFormatConfiguration.php
693 /src/Core/Image/ImageFormatConfigurationInterface.php
694 /classes/FeatureFlag.php
695 /src/Core/FeatureFlag/FeatureFlagSettings.php
696 /classes/ImageType.php
697 /src/Core/Domain/Shop/ValueObject/ShopId.php
698 /src/Core/Domain/Shop/ValueObject/ShopIdInterface.php
699 /modules/ps_emailsubscription/ps_emailsubscription.php
700 /src/Core/Module/WidgetInterface.php
701 /src/PrestaShopBundle/Translation/DomainNormalizer.php
702 /classes/Media.php
703 /modules/ps_facebook/ps_facebook.php
704 /modules/ps_facebook/translations/es.php
705 /modules/ps_metrics/vendor/prestashop/module-lib-service-container/src/DependencyInjection/ServiceContainer.php
706 /modules/ps_metrics/vendor/prestashop/module-lib-cache-directory-provider/src/Cache/CacheDirectoryProvider.php
707 /modules/ps_metrics/vendor/prestashop/module-lib-service-container/src/DependencyInjection/ContainerProvider.php
708 /var/cache/prod/Ps_facebookFrontContainer.php
709 /modules/ps_facebook/classes/Buffer/TemplateBuffer.php
710 /modules/ps_emailalerts/ps_emailalerts.php
711 /modules/ps_emailalerts/MailAlert.php
712 /src/Adapter/Presenter/Cart/CartLazyArray.php
713 /src/Adapter/Presenter/AbstractLazyArray.php
714 /src/Adapter/Product/PriceFormatter.php
715 /src/Core/Util/Inflector.php
716 /vendor/doctrine/inflector/lib/Doctrine/Inflector/InflectorFactory.php
717 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Language.php
718 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/InflectorFactory.php
719 /vendor/doctrine/inflector/lib/Doctrine/Inflector/GenericLanguageInflectorFactory.php
720 /vendor/doctrine/inflector/lib/Doctrine/Inflector/LanguageInflectorFactory.php
721 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Rules.php
722 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Ruleset.php
723 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformations.php
724 /vendor/doctrine/inflector/lib/Doctrine/Inflector/WordInflector.php
725 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Inflectible.php
726 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformation.php
727 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Pattern.php
728 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Patterns.php
729 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Uninflected.php
730 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitutions.php
731 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitution.php
732 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Word.php
733 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Inflector.php
734 /vendor/doctrine/inflector/lib/Doctrine/Inflector/CachedWordInflector.php
735 /vendor/doctrine/inflector/lib/Doctrine/Inflector/RulesetInflector.php
736 /classes/Gender.php
737 /classes/Risk.php
738 /classes/Meta.php
739 /classes/Address.php
740 /classes/State.php
741 /src/Core/Security/PasswordPolicyConfiguration.php
742 /src/Core/Configuration/DataConfigurationInterface.php
743 /src/Core/Security/Hashing.php
744 /src/Core/Filter/FrontEndObject/MainFilter.php
745 /src/Core/Filter/FilterInterface.php
746 /src/Core/Filter/FrontEndObject/CartFilter.php
747 /src/Core/Filter/HashMapWhitelistFilter.php
748 /src/Core/Filter/CollectionFilter.php
749 /src/Core/Filter/FrontEndObject/ProductFilter.php
750 /src/Core/Filter/FrontEndObject/EmbeddedAttributesFilter.php
751 /src/Core/Filter/FrontEndObject/CustomerFilter.php
752 /src/Core/Filter/FrontEndObject/ShopFilter.php
753 /src/Core/Filter/FrontEndObject/ConfigurationFilter.php
754 /modules/productcomments/productcomments.php
755 /modules/ps_shoppingcart/ps_shoppingcart.php
756 /modules/ps_facebook/classes/Handler/ErrorHandler/ErrorHandler.php
757 /modules/ps_facebook/classes/Config/Env.php
758 /modules/ps_facebook/classes/Handler/ErrorHandler/ModuleFilteredRavenClient.php
759 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/Client.php
760 /modules/ps_facebook/classes/Config/Config.php
761 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/Util.php
762 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/Compat.php
763 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/Processor/SanitizeDataProcessor.php
764 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/Processor.php
765 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/Context.php
766 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/Breadcrumbs.php
767 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/Serializer.php
768 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/ReprSerializer.php
769 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/TransactionStack.php
770 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/Breadcrumbs/ErrorHandler.php
771 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/Stacktrace.php
772 /modules/ps_facebook/vendor/prestashop/prestashop-accounts-installer/src/Installer/Facade/PsAccounts.php
773 /modules/ps_facebook/vendor/prestashop/prestashop-accounts-installer/src/Installer/Installer.php
774 /src/Core/Addon/Module/ModuleManagerBuilder.php
775 /src/Core/Util/File/YamlParser.php
776 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/SelfCheckingResourceChecker.php
777 /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerInterface.php
778 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/FileResource.php
779 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/SelfCheckingResourceInterface.php
780 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/ResourceInterface.php
781 /var/cache/prod/yaml/b57b1d618dfd4975fcf38dbdde58e4aa.php
782 /src/Adapter/LegacyLogger.php
783 /src/PrestaShopBundle/Service/DataProvider/Admin/CategoriesProvider.php
784 /src/Adapter/Module/ModuleDataProvider.php
785 /src/Adapter/Module/AdminModuleDataProvider.php
786 /src/PrestaShopBundle/Service/DataProvider/Admin/ModuleInterface.php
787 /src/Adapter/Module/Module.php
788 /src/Core/Module/ModuleInterface.php
789 /vendor/symfony/symfony/src/Symfony/Component/Config/FileLocator.php
790 /vendor/symfony/symfony/src/Symfony/Component/Config/FileLocatorInterface.php
791 /vendor/symfony/symfony/src/Symfony/Component/Routing/Loader/YamlFileLoader.php
792 /vendor/symfony/symfony/src/Symfony/Component/Config/Loader/FileLoader.php
793 /vendor/symfony/symfony/src/Symfony/Component/Config/Loader/Loader.php
794 /vendor/symfony/symfony/src/Symfony/Component/Config/Loader/LoaderInterface.php
795 /vendor/symfony/symfony/src/Symfony/Component/Routing/Router.php
796 /vendor/symfony/symfony/src/Symfony/Component/Routing/RouterInterface.php
797 /vendor/symfony/symfony/src/Symfony/Component/Routing/Matcher/UrlMatcherInterface.php
798 /vendor/symfony/symfony/src/Symfony/Component/Routing/RequestContextAwareInterface.php
799 /vendor/symfony/symfony/src/Symfony/Component/Routing/Generator/UrlGeneratorInterface.php
800 /vendor/symfony/symfony/src/Symfony/Component/Routing/Matcher/RequestMatcherInterface.php
801 /vendor/symfony/symfony/src/Symfony/Component/Routing/RequestContext.php
802 /src/Adapter/Module/ModuleDataUpdater.php
803 /src/Core/Module/ModuleManager.php
804 /src/Core/Module/ModuleManagerInterface.php
805 /src/Core/Module/ModuleRepository.php
806 /src/Core/Module/ModuleRepositoryInterface.php
807 /src/Adapter/HookManager.php
808 /src/Core/Module/SourceHandler/SourceHandlerFactory.php
809 /src/PrestaShopBundle/Event/Dispatcher/NullDispatcher.php
810 /vendor/symfony/symfony/src/Symfony/Component/EventDispatcher/EventDispatcherInterface.php
811 /vendor/symfony/contracts/EventDispatcher/EventDispatcherInterface.php
812 /modules/ps_metrics/vendor/psr/event-dispatcher/src/EventDispatcherInterface.php
813 /src/Core/Hook/HookDispatcherInterface.php
814 /modules/ps_accounts/ps_accounts.php
815 /modules/ps_accounts/vendor/autoload.php
816 /modules/ps_accounts/vendor/composer/autoload_real.php
817 /modules/ps_accounts/vendor/composer/platform_check.php
818 /modules/ps_accounts/vendor/composer/autoload_static.php
819 /modules/ps_accounts/vendor/paragonie/random_compat/lib/random.php
820 /modules/ps_accounts/vendor/symfony/polyfill-ctype/bootstrap.php
821 /modules/ps_accounts/vendor/lcobucci/jwt/compat/class-aliases.php
822 /modules/ps_accounts/vendor/lcobucci/jwt/src/Token.php
823 /modules/ps_accounts/vendor/lcobucci/jwt/src/Signature.php
824 /modules/ps_accounts/vendor/lcobucci/jwt/compat/json-exception-polyfill.php
825 /modules/ps_accounts/vendor/lcobucci/jwt/compat/lcobucci-clock-polyfill.php
826 /modules/ps_accounts/vendor/ramsey/uuid/src/functions.php
827 /modules/ps_accounts/src/Hook/HookableTrait.php
828 /modules/ps_accounts/src/Module/Install.php
829 /modules/ps_accounts/src/Settings/SettingsForm.php
830 /modules/ps_accounts/translations/es.php
831 /modules/ps_accounts/src/ServiceContainer/PsAccountsContainer.php
832 /modules/ps_accounts/vendor/prestashopcorp/lightweight-container/src/ServiceContainer/ServiceContainer.php
833 /modules/ps_accounts/config.php
834 /modules/ps_accounts/src/Log/Logger.php
835 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Logger.php
836 /modules/ps_accounts/vendor/psr/log/Psr/Log/LoggerInterface.php
837 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/ResettableInterface.php
838 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Handler/RotatingFileHandler.php
839 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Handler/StreamHandler.php
840 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Handler/AbstractProcessingHandler.php
841 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Handler/AbstractHandler.php
842 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Handler/HandlerInterface.php
843 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Utils.php
844 /modules/ps_accounts/src/ServiceProvider/ApiClientProvider.php
845 /modules/ps_accounts/vendor/prestashopcorp/lightweight-container/src/ServiceContainer/Contract/IServiceProvider.php
846 /modules/ps_accounts/src/ServiceProvider/CommandProvider.php
847 /modules/ps_accounts/src/ServiceProvider/DefaultProvider.php
848 /modules/ps_accounts/src/ServiceProvider/OAuth2Provider.php
849 /modules/ps_accounts/src/ServiceProvider/QueryProvider.php
850 /modules/ps_accounts/src/ServiceProvider/RepositoryProvider.php
851 /modules/ps_accounts/src/ServiceProvider/SessionProvider.php
852 /modules/ps_accounts/src/Service/PsAccountsService.php
853 /modules/ps_accounts/src/Account/Session/ShopSession.php
854 /modules/ps_accounts/src/Account/Session/Session.php
855 /modules/ps_accounts/src/Account/Session/SessionInterface.php
856 /modules/ps_accounts/src/Repository/ConfigurationRepository.php
857 /modules/ps_accounts/src/Adapter/Configuration.php
858 /modules/ps_accounts/src/Service/OAuth2/OAuth2Service.php
859 /modules/ps_accounts/src/Http/Client/ClientConfig.php
860 /modules/ps_accounts/src/Http/Client/ConfigObject.php
861 /modules/ps_accounts/src/Type/Enum.php
862 /modules/ps_accounts/src/Service/OAuth2/OAuth2Client.php
863 /modules/ps_accounts/src/Adapter/Link.php
864 /modules/ps_accounts/src/Context/ShopContext.php
865 /modules/ps_accounts/vendor/ramsey/uuid/src/Uuid.php
866 /modules/ps_accounts/vendor/ramsey/uuid/src/UuidInterface.php
867 /modules/ps_accounts/vendor/ramsey/uuid/src/UuidFactory.php
868 /modules/ps_accounts/vendor/ramsey/uuid/src/UuidFactoryInterface.php
869 /modules/ps_accounts/vendor/ramsey/uuid/src/FeatureSet.php
870 /modules/ps_accounts/vendor/ramsey/uuid/src/Converter/Number/DegradedNumberConverter.php
871 /modules/ps_accounts/vendor/ramsey/uuid/src/Converter/NumberConverterInterface.php
872 /modules/ps_accounts/vendor/ramsey/uuid/src/Builder/DefaultUuidBuilder.php
873 /modules/ps_accounts/vendor/ramsey/uuid/src/Builder/UuidBuilderInterface.php
874 /modules/ps_accounts/vendor/ramsey/uuid/src/Codec/StringCodec.php
875 /modules/ps_accounts/vendor/ramsey/uuid/src/Codec/CodecInterface.php
876 /modules/ps_accounts/vendor/ramsey/uuid/src/Provider/Node/FallbackNodeProvider.php
877 /modules/ps_accounts/vendor/ramsey/uuid/src/Provider/NodeProviderInterface.php
878 /modules/ps_accounts/vendor/ramsey/uuid/src/Provider/Node/SystemNodeProvider.php
879 /modules/ps_accounts/vendor/ramsey/uuid/src/Provider/Node/RandomNodeProvider.php
880 /modules/ps_accounts/vendor/ramsey/uuid/src/Generator/RandomGeneratorFactory.php
881 /modules/ps_accounts/vendor/ramsey/uuid/src/Generator/RandomBytesGenerator.php
882 /modules/ps_accounts/vendor/ramsey/uuid/src/Generator/RandomGeneratorInterface.php
883 /modules/ps_accounts/vendor/ramsey/uuid/src/Provider/Time/SystemTimeProvider.php
884 /modules/ps_accounts/vendor/ramsey/uuid/src/Provider/TimeProviderInterface.php
885 /modules/ps_accounts/vendor/ramsey/uuid/src/Generator/TimeGeneratorFactory.php
886 /modules/ps_accounts/vendor/ramsey/uuid/src/Converter/Time/PhpTimeConverter.php
887 /modules/ps_accounts/vendor/ramsey/uuid/src/Converter/TimeConverterInterface.php
888 /modules/ps_accounts/vendor/ramsey/uuid/src/Generator/DefaultTimeGenerator.php
889 /modules/ps_accounts/vendor/ramsey/uuid/src/Generator/TimeGeneratorInterface.php
890 /modules/ps_accounts/vendor/ramsey/uuid/src/BinaryUtils.php
891 /modules/ps_accounts/src/Service/OAuth2/CachedFile.php
892 /modules/ps_accounts/src/Account/Session/Firebase/ShopSession.php
893 /modules/ps_accounts/src/Account/Session/Firebase/FirebaseSession.php
894 /modules/ps_accounts/src/Account/Session/Firebase/OwnerSession.php
895 /modules/ps_accounts/src/Account/StatusManager.php
896 /modules/ps_accounts/src/Traits/WithOriginAndSourceTrait.php
897 /modules/ps_accounts/src/Traits/WithPropertyTrait.php
898 /modules/ps_accounts/src/Service/Accounts/AccountsService.php
899 /modules/ps_accounts/src/Service/AnalyticsService.php
900 /modules/ps_accounts/src/Service/AdminTokenService.php
901 /modules/ps_accounts/src/Adapter/ConfigurationKeys.php
902 /modules/ps_accounts/src/Account/CachedShopStatus.php
903 /modules/ps_accounts/src/Http/Resource/Resource.php
904 /modules/ps_accounts/src/Type/Dto.php
905 /modules/ps_accounts/src/Service/Accounts/Resource/ShopStatus.php
906 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/ErrorHandler.php
907 /modules/ps_facebook/classes/Dispatcher/EventDispatcher.php
908 /modules/ps_facebook/classes/Handler/ApiConversionHandler.php
909 /modules/ps_facebook/classes/Adapter/ConfigurationAdapter.php
910 /modules/ps_facebook/classes/Factory/ContextFactory.php
911 /modules/ps_facebook/classes/API/Client/FacebookClient.php
912 /modules/ps_facebook/classes/Factory/FacebookEssentialsApiClientFactory.php
913 /modules/ps_facebook/classes/Factory/ApiClientFactoryInterface.php
914 /modules/ps_facebook/classes/Provider/AccessTokenProvider.php
915 /modules/ps_facebook/classes/Factory/PsApiClientFactory.php
916 /modules/ps_facebook/classes/Handler/ConfigurationHandler.php
917 /modules/ps_facebook/classes/Http/HttpClient.php
918 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Api.php
919 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Session.php
920 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/SessionInterface.php
921 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/ApiConfig.php
922 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/Client.php
923 /modules/ps_facebook/classes/Handler/PixelHandler.php
924 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/MockFileSessionStorage.php
925 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/MockArraySessionStorage.php
926 /modules/ps_facebook/classes/Provider/EventDataProvider.php
927 /modules/ps_facebook/classes/Adapter/ToolsAdapter.php
928 /modules/ps_facebook/classes/Repository/ProductRepository.php
929 /modules/ps_facebook/classes/Provider/ProductAvailabilityProvider.php
930 /modules/ps_facebook/classes/Provider/ProductAvailabilityProviderInterface.php
931 /modules/ps_facebook/classes/Repository/GoogleCategoryRepository.php
932 /modules/ps_facebook/classes/Provider/GoogleCategoryProvider.php
933 /modules/ps_facebook/classes/Provider/GoogleCategoryProviderInterface.php
934 /classes/Combination.php
935 /classes/stock/StockAvailable.php
936 /classes/tax/Tax.php
937 /vendor/prestashop/decimal/src/DecimalNumber.php
938 /vendor/prestashop/decimal/src/Builder.php
939 /classes/SpecificPrice.php
940 /classes/tax/TaxManagerFactory.php
941 /classes/tax/TaxRulesTaxManager.php
942 /classes/tax/TaxManagerInterface.php
943 /classes/tax/TaxCalculator.php
944 /classes/GroupReduction.php
945 /src/Core/Localization/CLDR/ComputingPrecision.php
946 /src/Core/Localization/CLDR/ComputingPrecisionInterface.php
947 /classes/Pack.php
948 /classes/order/Order.php
949 /classes/Feature.php
950 /src/Core/Domain/Combination/CombinationSettings.php
951 /modules/ps_facebook/classes/Utility/ProductCatalogUtility.php
952 /src/Core/Util/String/StringModifier.php
953 /src/Core/Util/String/StringModifierInterface.php
954 /modules/ps_facebook/classes/Utility/CustomerInformationUtility.php
955 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/ServerSide/UserData.php
956 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/ServerSide/CustomData.php
957 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/ServerSide/Event.php
958 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/ServerSide/ActionSource.php
959 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Enum/AbstractEnum.php
960 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Enum/EnumInstanceInterface.php
961 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/ServerSide/EventRequest.php
962 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/ServerSide/HttpServiceClientConfig.php
963 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/ServerSide/Singleton.php
964 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/ServerSide/Util.php
965 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/ServerSide/Normalizer.php
966 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/AdsPixel.php
967 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/AbstractCrudObject.php
968 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/AbstractObject.php
969 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/Fields/AdsPixelFields.php
970 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/TypeChecker.php
971 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/Values/AdsPixelSortByValues.php
972 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/Values/AdsPixelAutomaticMatchingFieldsValues.php
973 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/Values/AdsPixelDataUseSettingValues.php
974 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/Values/AdsPixelFirstPartyCookieStatusValues.php
975 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/Values/AdsPixelPermittedTasksValues.php
976 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/Values/AdsPixelTasksValues.php
977 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/ApiRequest.php
978 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/RequestInterface.php
979 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Enum/EmptyEnum.php
980 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/Request.php
981 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/Parameters.php
982 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Logger/NullLogger.php
983 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Logger/LoggerInterface.php
984 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/Adapter/CurlAdapter.php
985 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/Adapter/AbstractAdapter.php
986 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/Adapter/AdapterInterface.php
987 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/Adapter/Curl/AbstractCurl.php
988 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/Adapter/Curl/CurlInterface.php
989 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/Adapter/Curl/Curl55.php
990 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/Response.php
991 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/ResponseInterface.php
992 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/Headers.php
993 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/ServerSide/EventResponse.php
994 /vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php
995 /var/cache/prod/smarty/compile/warehouse/7b/d6/67/7bd6674da24c9dfe787a4ab6d9f95992772bfd39_2.file.header.tpl.php
996 /vendor/smarty/smarty/libs/plugins/modifier.escape.php
997 /var/cache/prod/smarty/compile/warehouse/e4/c2/28/e4c22868c11d8c62c1db61f765dd994d1dfa43b9_2.file.fbTrack.tpl.php
998 /modules/psxmarketingwithgoogle/psxmarketingwithgoogle.php
999 /modules/psxmarketingwithgoogle/translations/es.php
1000 /var/cache/prod/PsxmarketingwithgoogleFrontContainer.php
1001 /modules/psxmarketingwithgoogle/classes/Adapter/ConfigurationAdapter.php
1002 /modules/psxmarketingwithgoogle/classes/Factory/ContextFactory.php
1003 /modules/psxmarketingwithgoogle/classes/config/Config.php
1004 /modules/psxmarketingwithgoogle/classes/Handler/RemarketingHookHandler.php
1005 /modules/psxmarketingwithgoogle/classes/Buffer/TemplateBuffer.php
1006 /modules/iqitcookielaw/iqitcookielaw.php
1007 /modules/iqitcookielaw/translations/es.php
1008 /modules/iqitmegamenu/iqitmegamenu.php
1009 /modules/iqitmegamenu/models/IqitMenuTab.php
1010 /modules/iqitmegamenu/models/IqitMenuHtml.php
1011 /modules/iqitmegamenu/models/IqitMenuLinks.php
1012 /modules/iqitmegamenu/translations/es.php
1013 /modules/iqitelementor/iqitelementor.php
1014 /modules/iqitelementor/src/IqitElementorLanding.php
1015 /modules/iqitelementor/src/IqitElementorTemplate.php
1016 /modules/iqitelementor/src/IqitElementorProduct.php
1017 /modules/iqitelementor/src/IqitElementorCategory.php
1018 /modules/iqitelementor/src/IqitElementorContent.php
1019 /modules/iqitelementor/src/iqitElementorWpHelper.php
1020 /modules/iqitelementor/includes/plugin-elementor.php
1021 /modules/iqitelementor/src/widgets/IqitElementorWidget_Brands.php
1022 /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsList.php
1023 /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsListTabs.php
1024 /modules/iqitelementor/src/widgets/IqitElementorWidget_Modules.php
1025 /modules/iqitelementor/src/widgets/IqitElementorWidget_CustomTpl.php
1026 /modules/iqitelementor/src/widgets/IqitElementorWidget_Menu.php
1027 /modules/iqitelementor/src/widgets/IqitElementorWidget_RevolutionSlider.php
1028 /modules/iqitelementor/src/widgets/IqitElementorWidget_Newsletter.php
1029 /modules/iqitelementor/src/widgets/IqitElementorWidget_Blog.php
1030 /modules/iqitelementor/src/widgets/IqitElementorWidget_Search.php
1031 /modules/iqitelementor/src/widgets/IqitElementorWidget_Links.php
1032 /modules/iqitelementor/src/widgets/IqitElementorWidget_ContactForm.php
1033 /modules/iqitelementor/translations/es.php
1034 /modules/nacex/nacex.php
1035 /modules/nacex/nacexWS.php
1036 /modules/nacex/nacexDTO.php
1037 /modules/nacex/AdminConfig.php
1038 /modules/nacex/UserGuide.php
1039 /modules/nacex/VInewServices.php
1040 /modules/nacex/nacexutils.php
1041 /modules/nacex/LBnewService.php
1042 /modules/nacex/nacexDAO.php
1043 /modules/nacex/ROnacexshop.php
1044 /modules/nacex/tratardatos.php
1045 /modules/nacex/nacexVIEW.php
1046 /modules/nacex/hash.php
1047 /classes/module/CarrierModule.php
1048 /modules/nacex/translations/es.php
1049 /src/Core/Product/Search/ProductSearchContext.php
1050 /src/Core/Product/Search/ProductSearchQuery.php
1051 /src/Core/Product/Search/SortOrder.php
1052 /modules/ps_facetedsearch/ps_facetedsearch.php
1053 /modules/ps_facetedsearch/src/HookDispatcher.php
1054 /modules/ps_facetedsearch/src/Hook/Attribute.php
1055 /modules/ps_facetedsearch/src/Hook/AbstractHook.php
1056 /modules/ps_facetedsearch/src/Hook/AttributeGroup.php
1057 /modules/ps_facetedsearch/src/Hook/Category.php
1058 /modules/ps_facetedsearch/src/Hook/Configuration.php
1059 /modules/ps_facetedsearch/src/Hook/Design.php
1060 /modules/ps_facetedsearch/src/Hook/Feature.php
1061 /modules/ps_facetedsearch/src/Form/Feature/FormModifier.php
1062 /modules/ps_facetedsearch/src/Form/Feature/FormDataProvider.php
1063 /modules/ps_facetedsearch/src/Hook/FeatureValue.php
1064 /modules/ps_facetedsearch/src/Form/FeatureValue/FormModifier.php
1065 /modules/ps_facetedsearch/src/Form/FeatureValue/FormDataProvider.php
1066 /modules/ps_facetedsearch/src/Hook/Product.php
1067 /modules/ps_facetedsearch/src/Hook/ProductSearch.php
1068 /modules/ps_facetedsearch/src/Hook/SpecificPrice.php
1069 /modules/ps_facetedsearch/src/Filters/Provider.php
1070 /modules/ps_facetedsearch/src/URLSerializer.php
1071 /modules/ps_facetedsearch/src/Filters/DataAccessor.php
1072 /modules/ps_facetedsearch/src/Product/SearchProvider.php
1073 /src/Core/Product/Search/FacetsRendererInterface.php
1074 /src/Core/Product/Search/ProductSearchProviderInterface.php
1075 /modules/ps_facetedsearch/src/Filters/Converter.php
1076 /modules/ps_facetedsearch/src/Product/SearchFactory.php
1077 /src/Core/Product/Search/ProductSearchResult.php
1078 /modules/ps_facetedsearch/src/Product/Search.php
1079 /modules/ps_facetedsearch/src/Adapter/MySQL.php
1080 /modules/ps_facetedsearch/src/Adapter/AbstractAdapter.php
1081 /modules/ps_facetedsearch/src/Adapter/InterfaceAdapter.php
1082 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ArrayCollection.php
1083 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Collection.php
1084 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ReadableCollection.php
1085 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Selectable.php
1086 /modules/ps_facetedsearch/src/Filters/Products.php
1087 /modules/ps_facetedsearch/src/Filters/Block.php
1088 /src/Core/Product/Search/Facet.php
1089 /src/Core/Product/Search/Filter.php
1090 /src/Core/Product/Search/FacetCollection.php
1091 /classes/ProductAssembler.php
1092 /classes/Manufacturer.php
1093 /classes/ProductPresenterFactory.php
1094 /src/Adapter/Presenter/Product/ProductListingPresenter.php
1095 /src/Adapter/Presenter/Product/ProductPresenter.php
1096 /src/Adapter/Product/ProductColorsRetriever.php
1097 /src/Core/Product/ProductPresentationSettings.php
1098 /src/Adapter/Presenter/Product/ProductListingLazyArray.php
1099 /src/Adapter/Presenter/Product/ProductLazyArray.php
1100 /classes/Image.php
1101 /var/cache/prod/smarty/compile/warehouse/d4/1d/65/d41d65d76b9471b5d365fe06cf1737c89a53af9f_2.module.ps_facetedsearchviewstemplatesfrontcatalogfacets.tpl.php
1102 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_block.php
1103 /vendor/smarty/smarty/libs/plugins/modifier.count.php
1104 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php
1105 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_foreach.php
1106 /var/cache/prod/smarty/compile/warehouse/2e/80/73/2e807335546cfa2360c36327ac89dd2fcb054379_2.module.ps_facetedsearchviewstemplatesfrontcatalogactivefilters.tpl.php
1107 /src/Core/Product/Search/Pagination.php
1108 /vendor/defuse/php-encryption/src/Crypto.php
1109 /vendor/defuse/php-encryption/src/KeyOrPassword.php
1110 /vendor/defuse/php-encryption/src/RuntimeTests.php
1111 /vendor/defuse/php-encryption/src/DerivedKeys.php
1112 /vendor/defuse/php-encryption/src/Exception/WrongKeyOrModifiedCiphertextException.php
1113 /vendor/defuse/php-encryption/src/Exception/CryptoException.php
1114 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/75/a6/42/75a64202e97931196bc7ffc62f78ffd65260f53c_2.file.category.tpl.php
1115 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_capture.php
1116 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/94/12/cc/9412ccef9680927153b45c6ae144d544996206b6_2.file.product-list.tpl.php
1117 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/b9/42/2f/b9422fde64d87165f5f5c624a4cbefbe5f5cc591_2.file.layout-left-column.tpl.php
1118 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/d2/95/d8/d295d85097e23dfc619a6d9948f9bb0871953825_2.file.layout-both-columns.tpl.php
1119 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/48/f1/3f/48f13f505ce53fe1a91e5a59ff252495434ac43d_2.file.helpers.tpl.php
1120 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_tplfunction.php
1121 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/1b/22/bc/1b22bcae0a59cc6b48cc1c9c25235f501651e518_2.file.head.tpl.php
1122 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/41/92/2e/41922ed228227013af99527db113ad08c91d4c9b_2.file.head-jsonld.tpl.php
1123 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/e2/41/5c/e2415c4af2ebd285942a955984af4b4e1aa22189_2.file.product-list-jsonld.tpl.php
1124 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/04/1b/47/041b4759bcd23a9de0adfa67f3a43b8b64636a07_2.file.pagination-seo.tpl.php
1125 /vendor/smarty/smarty/libs/plugins/modifier.replace.php
1126 /vendor/smarty/smarty/libs/plugins/shared.mb_str_replace.php
1127 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/43/32/e4/4332e4a9374e52ec03407d255e0717700fe0ae38_2.file.stylesheets.tpl.php
1128 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/ad/11/eb/ad11ebbbe1d132c2eb222c363cd04b3dee98d8fb_2.file.javascript.tpl.php
1129 /classes/ProductDownload.php
1130 /src/Core/Cart/Calculator.php
1131 /src/Core/Cart/CartRowCollection.php
1132 /src/Core/Cart/Fees.php
1133 /src/Core/Cart/AmountImmutable.php
1134 /src/Core/Cart/CartRuleCollection.php
1135 /src/Core/Cart/CartRuleCalculator.php
1136 /src/Adapter/Product/PriceCalculator.php
1137 /src/Core/Cart/CartRow.php
1138 /vendor/symfony/symfony/src/Symfony/Component/Translation/PluralizationRules.php
1139 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/b3/9c/46/b39c46fe99acdbe1574e9b876a398a0024152c16_2.file.product-activation.tpl.php
1140 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/da/79/cf/da79cf6aab6675d177369043b59a83d42869b4f0_2.file.header.tpl.php
1141 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/6a/a2/df/6aa2dfd27b196571f30e719112e04b70f089f033_2.file.social-links.tpl.php
1142 /modules/iqitlinksmanager/iqitlinksmanager.php
1143 /modules/iqitlinksmanager/src/IqitLinkBlockRepository.php
1144 /modules/iqitlinksmanager/src/IqitLinkBlock.php
1145 /modules/iqitlinksmanager/src/IqitLinkBlockPresenter.php
1146 /modules/iqitlinksmanager/translations/es.php
1147 /vendor/smarty/smarty/libs/sysplugins/smarty_template_cached.php
1148 /vendor/smarty/smarty/libs/sysplugins/smarty_cacheresource.php
1149 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_cacheresource_file.php
1150 /var/cache/prod/smarty/cache/iqitlinksmanager/1/1/1/6/displayNav1/warehouse/00/9f/22/009f22a54fda4ac75973e63c46f0132b1119ba03.iqitlinksmanagerviewstemplateshookiqitlinksmanager.tpl.php
1151 /modules/ps_languageselector/ps_languageselector.php
1152 /modules/ps_currencyselector/ps_currencyselector.php
1153 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/08/d5/04/08d504d7a022befca93803f3e17505b861ca8248_2.file.header-3.tpl.php
1154 /modules/iqitsearch/iqitsearch.php
1155 /modules/iqitsearch/translations/es.php
1156 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_gettemplatevars.php
1157 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/d9/9b/94/d99b947421dcff226f28b1d6cb674c91f17399db_2.module.iqitsearchviewstemplateshookiqitsearchbtn.tpl.php
1158 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/46/29/db/4629dbb3c4efa13c090c633dc2e46e5f2b42bed3_2.module.iqitsearchviewstemplateshooksearchbar.tpl.php
1159 /modules/ps_customersignin/ps_customersignin.php
1160 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/72/be/19/72be192e406191c1cad554abe284e159adeb4234_2.module.ps_customersigninps_customersigninbtn.tpl.php
1161 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/b4/a4/76/b4a476e0a8201677b298f7c0f8ca1ac698e1bac3_2.module.ps_shoppingcartps_shoppingcartbtn.tpl.php
1162 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/35/65/5e/35655e6409b6198f29dd6e732ef9598dec599880_2.module.ps_shoppingcartps_shoppingcart.tpl.php
1163 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/f6/e9/f2/f6e9f2b1680a466582d2199d038efe2cfa3a83f7_2.module.ps_shoppingcartps_shoppingcartcontent.tpl.php
1164 /var/cache/prod/smarty/cache/iqitmegamenu/index/1/1/1/6/warehouse/0e/3d/e6/0e3de6994bee6e3198146e208ce6beab444c9b4c.iqitmegamenuviewstemplateshookhorizontal.tpl.php
1165 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/cc/19/65/cc196527306127f5e0d92c634bf0405f2119a661_2.file.mobile-header-2.tpl.php
1166 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/7a/30/38/7a3038780284d52e9fcd7a66e51e5b86a166106b_2.module.iqitsearchviewstemplateshooksearchbarmobile.tpl.php
1167 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/be/ee/e6/beeee6f3d87613010f8af1cabc4c4562f8cf600a_2.module.ps_customersigninps_customersigninmobile.tpl.php
1168 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/d4/e1/57/d4e1571b6b210795247564db06deb17061778b51_2.module.ps_shoppingcartps_shoppingcartmqty.tpl.php
1169 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/90/d8/0a/90d80a9022c08011c7d753c6c3e409a4ae5b7fda_2.file.breadcrumb.tpl.php
1170 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/19/19/82/191982fa1e9d343688d9b381fea21c314a7ebef3_2.file.notifications.tpl.php
1171 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/3f/08/79/3f087969496cb1217bbe01ca6f95bbcaae18b1cf_2.file.category-header.tpl.php
1172 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/3e/fc/5c/3efc5c6cabf68a518dde9956926db6cf60a93dd5_2.file.products-top.tpl.php
1173 /vendor/smarty/smarty/libs/plugins/modifier.regex_replace.php
1174 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/5e/be/46/5ebe46ba384c4e31c6497e544847aec50e2df7ed_2.file.sort-orders.tpl.php
1175 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/df/95/52/df9552fec00c67a219e4d30c27efc6f3e649e435_2.file.products.tpl.php
1176 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/55/7a/be/557abe380aacf1dcc82a9614401a41c90059c373_2.file.product.tpl.php
1177 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/83/21/1d/83211d3e18c7848aecc64c18474f33bc0ea7cd65_2.file.product-miniature-1.tpl.php
1178 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/0a/d6/ba/0ad6ba9370f144df31a3308c307c61383af0f46f_2.file.product-miniature-thumb.tpl.php
1179 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/54/f1/31/54f131cbfede74c5ff970f4d07b4366036e2f8db_2.file.product-miniature-btn.tpl.php
1180 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/c2/18/5e/c2185e235e559bf004db69cd2c6a7703df41adb0_2.file.pagination.tpl.php
1181 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/5e/fc/91/5efc91d7387e3670df18e3cf6645652c4546f7c9_2.file.products-bottom.tpl.php
1182 /var/cache/prod/smarty/compile/warehouse/81/a1/04/81a1040ed0eeab6f58198f9907167c7fced628c5_2.module.ps_facetedsearchps_facetedsearch.tpl.php
1183 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/36/7c/da/367cdad5e95c9d0937b2526e141cbe7cc11d72f9_2.file.footer.tpl.php
1184 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/2c/ca/be/2ccabe66f524058310a6818abce4e6d56ee1bb64_2.file.footer-1.tpl.php
1185 /var/cache/prod/smarty/cache/iqitlinksmanager/1/1/1/6/displayFooter/warehouse/00/9f/22/009f22a54fda4ac75973e63c46f0132b1119ba03.iqitlinksmanagerviewstemplateshookiqitlinksmanager.tpl.php
1186 /modules/corewhatsapp/corewhatsapp.php
1187 /modules/corewhatsapp/classes/Corewhatsapp.php
1188 /var/cache/prod/smarty/compile/warehouse/f3/d9/ed/f3d9ed074127cff4b22b15d975f7cd788fe3a35d_2.file.corewhatsapp.tpl.php
1189 /var/cache/prod/smarty/compile/warehouse/30/7d/c6/307dc6bd4724d29d1572cc301dd7148e962604ef_2.module.ps_emailsubscriptionviewstemplateshookps_emailsubscription.tpl.php
1190 /modules/psgdpr/psgdpr.php
1191 /modules/psgdpr/translations/es.php
1192 /modules/psgdpr/classes/GDPRConsent.php
1193 /var/cache/prod/smarty/compile/warehouse/5e/ee/24/5eee242e5cbca9bb89b8ffa439cebef7beaaf2e4_2.module.psgdprviewstemplateshookdisplayGDPRConsent.tpl.php
1194 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/94/7d/69/947d69d2647da7c0eeb75ef9497030be726dc5dc_2.file.footer-copyrights-1.tpl.php
1195 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/ef/d8/5e/efd85eed67e0be9a97e7376c50dacb5344f76046_2.file.password-policy-template.tpl.php
1196 /var/cache/prod/smarty/cache/iqitcookielaw/1/1/1/6/warehouse/e7/7b/d0/e77bd029c1dc3735e3f4798f608cdf3e90a317c6.iqitcookielawviewstemplateshookiqitcookielaw.tpl.php
1197 /modules/statsdata/statsdata.php
1198 /classes/Guest.php
1199 /classes/Connection.php
1200 /classes/Page.php
1201 /classes/ConnectionsSource.php