Inicio

Utilizamos cookies propias y de terceros para mejorar nuestros servicios y mostrarle publicidad

relacionada con sus preferencias mediante el análisis de sus hábitos de navegación. Puede

consultar nuestra Política de cookies  aquí

Load Time 898 ms
Querying Time 426 ms
Queries 846
Memory Peak Usage 16.3 Mb
Included Files 1200 files - 11.78 Mb
PrestaShop Cache - Mb
Global vars 0.25 Mb
PrestaShop Version 8.2.4
PHP Version 8.2.30
MySQL Version 10.3.39-MariaDB
Memory Limit 256M
Max Execution Time 120s
Smarty Cache enabled
Smarty Compilation never recompile
  Time Cumulated Time Memory Usage Memory Peak Usage
config 43.049 ms 43.049 ms 2.15 Mb 2.1 Mb
__construct 1.627 ms 44.676 ms - Mb 2.7 Mb
init 22.557 ms 67.233 ms 1.03 Mb 3.3 Mb
checkAccess 0.002 ms 67.235 ms - Mb 3.3 Mb
setMedia 2.452 ms 69.687 ms 0.04 Mb 3.3 Mb
postProcess 0.002 ms 69.689 ms - Mb 3.3 Mb
initHeader 0.001 ms 69.690 ms - Mb 3.3 Mb
initContent 779.864 ms 850 ms 10.00 Mb 13.3 Mb
initFooter 0.002 ms 850 ms - Mb 13.3 Mb
display 47.990 ms 898 ms 2.38 Mb 16.3 Mb
Hook Time Memory Usage
DisplayHeader 467.056 ms 4.60 Mb
DisplayBeforeBodyClosingTag 6.903 ms 0.08 Mb
displayFooter 2.472 ms 0.17 Mb
displayNav1 1.096 ms 0.08 Mb
DisplayGDPRConsent 0.996 ms 0.09 Mb
ProductSearchProvider 0.929 ms - Mb
DisplayFooter 0.838 ms 0.05 Mb
displayMainMenu 0.768 ms 0.11 Mb
displayBeforeBodyClosingTag 0.725 ms 0.04 Mb
displayNav2 0.501 ms 0.08 Mb
ActionFrontControllerSetMedia 0.442 ms 0.01 Mb
DisplayLeftColumn 0.390 ms 0.11 Mb
IsJustElementor 0.165 ms 0.02 Mb
displayVerticalMenu 0.016 ms - Mb
ActionDispatcher 0.010 ms - Mb
ActionProductSearchAfter 0.007 ms - Mb
Header 0.004 ms - Mb
17 hook(s) 483.317 ms 5.45 Mb
Module Time Memory Usage
iqitthemeeditor 1.542 ms 0.11 Mb
ps_emailsubscription 2.470 ms 0.16 Mb
ps_facebook 464.093 ms 4.52 Mb
ps_emailalerts 0.196 ms 0.01 Mb
productcomments 0.371 ms 0.01 Mb
ps_shoppingcart 0.124 ms 0.01 Mb
ps_accounts 1.354 ms 0.01 Mb
psxmarketingwithgoogle 1.660 ms 0.01 Mb
iqitcookielaw 1.664 ms 0.07 Mb
iqitmegamenu 1.806 ms 0.15 Mb
iqitelementor 1.801 ms 0.08 Mb
nacex 1.514 ms 0.18 Mb
ps_facetedsearch 2.807 ms 0.13 Mb
iqitlinksmanager 1.914 ms 0.12 Mb
ps_languageselector 0.352 ms 0.05 Mb
ps_currencyselector 0.323 ms 0.05 Mb
iqitsearch 0.336 ms 0.01 Mb
ps_customersignin 0.106 ms 0.02 Mb
corewhatsapp 0.958 ms 0.06 Mb
psgdpr 1.270 ms 0.10 Mb
statsdata 6.617 ms 0.05 Mb
21 module(s) 493.277 ms 5.89 Mb

Stopwatch SQL - 846 queries

# Query Time (ms) Rows Filesort Group By Location
421
SELECT SQL_NO_CACHE cp.id_category, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' GROUP BY p.id_product) p INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE cg.id_group='1' AND c.nleft>2 AND c.nright<197 GROUP BY cp.id_category
81.159 ms 25623844 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
79
SELECT SQL_NO_CACHE p.*, product_shop.*, stock.out_of_stock, IFNULL(stock.quantity, 0) AS quantity, IFNULL(product_attribute_shop.id_product_attribute, 0) AS id_product_attribute,
product_attribute_shop.minimal_quantity AS product_attribute_minimal_quantity, pl.`description`, pl.`description_short`, pl.`available_now`,
pl.`available_later`, pl.`link_rewrite`, pl.`meta_description`, pl.`meta_keywords`, pl.`meta_title`, pl.`name`, image_shop.`id_image` id_image,
il.`legend` as legend, m.`name` AS manufacturer_name, cl.`name` AS category_default,
DATEDIFF(product_shop.`date_add`, DATE_SUB("2026-04-13 00:00:00",
INTERVAL 30 DAY)) > 0 AS new, product_shop.price AS orderprice
FROM `prstshp_category_product` cp
LEFT JOIN `prstshp_product` p
ON p.`id_product` = cp.`id_product`
INNER JOIN prstshp_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1) LEFT JOIN `prstshp_product_attribute_shop` product_attribute_shop
ON (p.`id_product` = product_attribute_shop.`id_product` AND product_attribute_shop.`default_on` = 1 AND product_attribute_shop.id_shop=1)
LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `p`.id_product AND stock.id_product_attribute = 0 AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `prstshp_category_lang` cl
ON (product_shop.`id_category_default` = cl.`id_category`
AND cl.`id_lang` = 2 AND cl.id_shop = 1 )
LEFT JOIN `prstshp_product_lang` pl
ON (p.`id_product` = pl.`id_product`
AND pl.`id_lang` = 2 AND pl.id_shop = 1 )
LEFT JOIN `prstshp_image_shop` image_shop
ON (image_shop.`id_product` = p.`id_product` AND image_shop.cover=1 AND image_shop.id_shop=1)
LEFT JOIN `prstshp_image_lang` il
ON (image_shop.`id_image` = il.`id_image`
AND il.`id_lang` = 2)
LEFT JOIN `prstshp_manufacturer` m
ON m.`id_manufacturer` = p.`id_manufacturer`
WHERE product_shop.`id_shop` = 1
AND cp.`id_category` = 2 AND product_shop.`active` = 1 AND product_shop.`visibility` IN ("both", "catalog") ORDER BY cp.`position` ASC
LIMIT 480,24
54.210 ms 5250 Yes /classes/Category.php:1062
417
SELECT SQL_NO_CACHE p.id_product FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND cp.id_category IN (18, 70, 124, 113) GROUP BY p.id_product) p GROUP BY p.id_product ORDER BY p.date_add DESC, p.id_product DESC
34.229 ms 5692996 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
419
SELECT SQL_NO_CACHE psi.price_min, MIN(price_min) as min, MAX(price_max) as max FROM prstshp_product p INNER JOIN prstshp_layered_price_index psi ON (psi.id_product = p.id_product AND psi.id_shop = 1 AND psi.id_currency = 2 AND psi.id_country = 6) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND cp.id_category IN (18, 70, 124, 113)
20.084 ms 2386 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
422
REPLACE INTO prstshp_layered_filter_block (hash, data) VALUES ("14e7206e5d2ec0d7bf3028471eb77ad5", "a:1:{s:7:\"filters\";a:2:{i:0;a:12:{s:9:\"type_lite\";s:5:\"price\";s:4:\"type\";s:5:\"price\";s:6:\"id_key\";i:0;s:4:\"name\";s:6:\"Precio\";s:3:\"max\";d:895;s:3:\"min\";d:0;s:4:\"unit\";s:3:\"€\";s:14:\"specifications\";a:11:{s:6:\"symbol\";a:11:{i:0;s:1:\",\";i:1;s:1:\".\";i:2;s:1:\";\";i:3;s:1:\"%\";i:4;s:1:\"-\";i:5;s:1:\"+\";i:6;s:1:\"E\";i:7;s:2:\"×\";i:8;s:3:\"‰\";i:9;s:3:\"∞\";i:10;s:3:\"NaN\";}s:12:\"currencyCode\";s:3:\"EUR\";s:14:\"currencySymbol\";s:3:\"€\";s:13:\"numberSymbols\";a:11:{i:0;s:1:\",\";i:1;s:1:\".\";i:2;s:1:\";\";i:3;s:1:\"%\";i:4;s:1:\"-\";i:5;s:1:\"+\";i:6;s:1:\"E\";i:7;s:2:\"×\";i:8;s:3:\"‰\";i:9;s:3:\"∞\";i:10;s:3:\"NaN\";}s:15:\"positivePattern\";s:12:\"#,##0.00 ¤\";s:15:\"negativePattern\";s:13:\"-#,##0.00 ¤\";s:17:\"maxFractionDigits\";i:2;s:17:\"minFractionDigits\";i:2;s:12:\"groupingUsed\";b:1;s:16:\"primaryGroupSize\";i:3;s:18:\"secondaryGroupSize\";i:3;}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:3;s:3:\"nbr\";i:1108;s:5:\"value\";N;}i:1;a:7:{s:9:\"type_lite\";s:8:\"category\";s:4:\"type\";s:8:\"category\";s:6:\"id_key\";i:0;s:4:\"name\";s:11:\"Categorías\";s:6:\"values\";a:76:{i:14;a:2:{s:4:\"name\";s:7:\"RELOJES\";s:3:\"nbr\";s:3:\"374\";}i:15;a:2:{s:4:\"name\";s:12:\"JOYAS DE ORO\";s:3:\"nbr\";s:3:\"404\";}i:16;a:2:{s:4:\"name\";s:9:\"ORO DE 9K\";s:3:\"nbr\";s:3:\"100\";}i:17;a:2:{s:4:\"name\";s:5:\"ACERO\";s:3:\"nbr\";s:3:\"269\";}i:18;a:3:{s:4:\"name\";s:14:\"JOYAS DE PLATA\";s:3:\"nbr\";s:4:\"1075\";s:7:\"checked\";b:1;}i:19;a:2:{s:4:\"name\";s:6:\"BRONCE\";s:3:\"nbr\";s:1:\"5\";}i:20;a:2:{s:4:\"name\";s:11:\"SMART WATCH\";s:3:\"nbr\";s:2:\"16\";}i:21;a:2:{s:4:\"name\";s:18:\"RELOJES INFANTILES\";s:3:\"nbr\";s:2:\"22\";}i:23;a:2:{s:4:\"name\";s:14:\"RELOJES SEÑOR\";s:3:\"nbr\";s:3:\"178\";}i:24;a:2:{s:4:\"name\";s:15:\"RELOJES SEÑORA\";s:3:\"nbr\";s:3:\"151\";}i:25;a:2:{s:4:\"name\";s:23:\"RELOJES NIÑA COMUNIÓN\";s:3:\"nbr\";s:1:\"4\";}i:26;a:2:{s:4:\"name\";s:23:\"RELOJES NIÑO COMUNIÓN\";s:3:\"nbr\";s:1:\"3\";}i:27;a:2:{s:4:\"name\";s:16:\"COLGANTES DE ORO\";s:3:\"nbr\";s:2:\"46\";}i:28;a:2:{s:4:\"name\";s:15:\"PULSERAS DE ORO\";s:3:\"nbr\";s:2:\"34\";}i:29;a:2:{s:4:\"name\";s:17:\"PULSERA  BEBE ORO\";s:3:\"nbr\";s:1:\"3\";}i:31;a:2:{s:4:\"name\";s:14:\"PENDIENTES ORO\";s:3:\"nbr\";s:2:\"55\";}i:32;a:2:{s:4:\"name\";s:15:\"PIERCING DE ORO\";s:3:\"nbr\";s:2:\"14\";}i:33;a:2:{s:4:\"name\";s:20:\"PENDIENTES BEBÉ ORO\";s:3:\"nbr\";s:2:\"40\";}i:34;a:2:{s:4:\"name\";s:14:\"ANILLOS DE ORO\";s:3:\"nbr\";s:3:\"127\";}i:35;a:2:{s:4:\"name\";s:19:\"GARGANTILLAS DE ORO\";s:3:\"nbr\";s:2:\"40\";}i:36;a:2:{s:4:\"name\";s:17:\"PULSERA DE ORO 9K\";s:3:\"nbr\";s:2:\"21\";}i:37;a:2:{s:4:\"name\";s:13:\"ANILLO ORO 9K\";s:3:\"nbr\";s:2:\"19\";}i:38;a:2:{s:4:\"name\";s:17:\"PENDIENTES ORO 9K\";s:3:\"nbr\";s:2:\"30\";}i:39;a:2:{s:4:\"name\";s:21:\"GARGANTILLA ORO DE 9K\";s:3:\"nbr\";s:2:\"29\";}i:41;a:2:{s:4:\"name\";s:13:\"ANILLOS ACERO\";s:3:\"nbr\";s:2:\"34\";}i:42;a:2:{s:4:\"name\";s:17:\"PULSERA DE ACERO \";s:3:\"nbr\";s:3:\"129\";}i:43;a:2:{s:4:\"name\";s:16:\"PENDIENTES ACERO\";s:3:\"nbr\";s:2:\"54\";}i:44;a:2:{s:4:\"name\";s:18:\"GARGANTILLA ACERO \";s:3:\"nbr\";s:2:\"30\";}i:45;a:2:{s:4:\"name\";s:7:\"LLAVERO\";s:3:\"nbr\";s:1:\"9\";}i:46;a:2:{s:4:\"name\";s:9:\"TOBILLERA\";s:3:\"nbr\";s:2:\"13\";}i:47;a:2:{s:4:\"name\";s:26:\"JOYAS PERSONALIZADAS PLATA\";s:3:\"nbr\";s:2:\"16\";}i:48;a:2:{s:4:\"name\";s:19:\"COLECCIÓN INFANTIL\";s:3:\"nbr\";s:2:\"29\";}i:49;a:2:{s:4:\"name\";s:13:\"PULSERA PLATA\";s:3:\"nbr\";s:3:\"157\";}i:50;a:2:{s:4:\"name\";s:13:\"ANILLOS PLATA\";s:3:\"nbr\";s:3:\"188\";}i:51;a:2:{s:4:\"name\";s:16:\"PENDIENTES PLATA\";s:3:\"nbr\";s:3:\"356\";}i:52;a:2:{s:4:\"name\";s:4:\"AROS\";s:3:\"nbr\";s:1:\"6\";}i:53;a:2:{s:4:\"name\";s:8:\"PIERCING\";s:3:\"nbr\";s:2:\"25\";}i:54;a:2:{s:4:\"name\";s:22:\"PENDIENTES BEBÉ PLATA\";s:3:\"nbr\";s:2:\"11\";}i:55;a:2:{s:4:\"name\";s:17:\"GARGANTILLA PLATA\";s:3:\"nbr\";s:3:\"205\";}i:56;a:2:{s:4:\"name\";s:22:\"GARGANTILLAS INICIALES\";s:3:\"nbr\";s:1:\"4\";}i:57;a:2:{s:4:\"name\";s:6:\"CHOKER\";s:3:\"nbr\";s:1:\"1\";}i:59;a:2:{s:4:\"name\";s:10:\"JOYAS MAMA\";s:3:\"nbr\";s:2:\"31\";}i:61;a:2:{s:4:\"name\";s:8:\"EAR CUFF\";s:3:\"nbr\";s:1:\"5\";}i:62;a:2:{s:4:\"name\";s:22:\"PULSERA ACERO COMUNION\";s:3:\"nbr\";s:1:\"1\";}i:63;a:2:{s:4:\"name\";s:18:\"LLAMADOR DE ÁNGEL\";s:3:\"nbr\";s:1:\"3\";}i:64;a:2:{s:4:\"name\";s:14:\"COLGANTE PLATA\";s:3:\"nbr\";s:2:\"15\";}i:66;a:2:{s:4:\"name\";s:24:\"DETALLES PARA PROFESORES\";s:3:\"nbr\";s:2:\"21\";}i:68;a:2:{s:4:\"name\";s:17:\"COLECCIÓN LORENA\";s:3:\"nbr\";s:1:\"8\";}i:70;a:3:{s:4:\"name\";s:24:\"JOYAS PERSONALIZADAS ORO\";s:3:\"nbr\";s:1:\"4\";s:7:\"checked\";b:1;}i:74;a:2:{s:4:\"name\";s:7:\"AROS 9K\";s:3:\"nbr\";s:1:\"1\";}i:79;a:2:{s:4:\"name\";s:13:\"RELOJ SEÑORA\";s:3:\"nbr\";s:1:\"1\";}i:80;a:2:{s:4:\"name\";s:15:\"RELOJES SEÑORA\";s:3:\"nbr\";s:1:\"1\";}i:86;a:2:{s:4:\"name\";s:9:\"COMUNIÓN\";s:3:\"nbr\";s:2:\"21\";}i:87;a:2:{s:4:\"name\";s:13:\"DIA DEL PADRE\";s:3:\"nbr\";s:2:\"68\";}i:92;a:2:{s:4:\"name\";s:15:\"COLECCIÓN ané\";s:3:\"nbr\";s:1:\"5\";}i:93;a:2:{s:4:\"name\";s:15:\"JOYERÍA HOMBRE\";s:3:\"nbr\";s:2:\"20\";}i:94;a:2:{s:4:\"name\";s:9:\"TOBILLERA\";s:3:\"nbr\";s:1:\"4\";}i:95;a:2:{s:4:\"name\";s:16:\"TOBILLERA DE ORO\";s:3:\"nbr\";s:1:\"3\";}i:98;a:2:{s:4:\"name\";s:15:\"ALIANZAS DE ORO\";s:3:\"nbr\";s:1:\"1\";}i:102;a:2:{s:4:\"name\";s:10:\"CADENA ORO\";s:3:\"nbr\";s:1:\"4\";}i:104;a:2:{s:4:\"name\";s:20:\"sello hombre oro 18k\";s:3:\"nbr\";s:1:\"7\";}i:105;a:2:{s:4:\"name\";s:7:\"ALIANZA\";s:3:\"nbr\";s:2:\"15\";}i:106;a:2:{s:4:\"name\";s:18:\"COLGANTES DE ACERO\";s:3:\"nbr\";s:1:\"2\";}i:107;a:2:{s:4:\"name\";s:14:\"ALIANZAS ACERO\";s:3:\"nbr\";s:1:\"3\";}i:112;a:2:{s:4:\"name\";s:16:\"PENDIENTES PLATA\";s:3:\"nbr\";s:1:\"1\";}i:113;a:3:{s:4:\"name\";s:7:\"PENJOLL\";s:3:\"nbr\";s:1:\"1\";s:7:\"checked\";b:1;}i:115;a:2:{s:4:\"name\";s:5:\"LATON\";s:3:\"nbr\";s:1:\"3\";}i:116;a:2:{s:4:\"name\";s:18:\"LLAMADOR DE ÁNGEL\";s:3:\"nbr\";s:1:\"3\";}i:117;a:2:{s:4:\"name\";s:15:\"Sant Fèlix 325\";s:3:\"nbr\";s:1:\"9\";}i:118;a:2:{s:4:\"name\";s:9:\"TOBILLERA\";s:3:\"nbr\";s:1:\"5\";}i:119;a:2:{s:4:\"name\";s:7:\"GEMELOS\";s:3:\"nbr\";s:1:\"2\";}i:121;a:2:{s:4:\"name\";s:23:\"ANILLOS ORO & CIRCONITA\";s:3:\"nbr\";s:1:\"1\";}i:122;a:2:{s:4:\"name\";s:16:\"CLAUDIA CAMPILLO\";s:3:\"nbr\";s:1:\"1\";}i:123;a:2:{s:4:\"name\";s:24:\"DIAMANTES DE LABORATORIO\";s:3:\"nbr\";s:2:\"12\";}i:124;a:3:{s:4:\"name\";s:7:\"ORO 14K\";s:3:\"nbr\";s:2:\"28\";s:7:\"checked\";b:1;}i:125;a:2:{s:4:\"name\";s:15:\"PIERCING DE 14K\";s:3:\"nbr\";s:2:\"27\";}}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";s:1:\"0\";}}}")
17.345 ms 1 /modules/ps_facetedsearch/src/Filters/Block.php:209
409
SELECT SQL_NO_CACHE `name`
FROM `prstshp_hook`
WHERE `id_hook` = 746 LIMIT 1
16.866 ms 1 /classes/Hook.php:244
844
INSERT INTO `prstshp_connections_source` (`id_connections`, `http_referer`, `request_uri`, `keywords`, `date_add`) VALUES ('3169', '', 'www.joieriaorfi.es/2-inicio?page=21&q=Categor%C3%ADas-JOYAS+DE+PLATA-JOYAS+PERSONALIZADAS+ORO-ORO+14K-PENJOLL-DIAMANTES+DE+LABORATORIO', '', '2026-04-13 13:19:32')
5.659 ms 1 /classes/ObjectModel.php:622
178
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 14 LIMIT 1
5.106 ms 1 /classes/Product.php:5670
472
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3308
ORDER BY f.position ASC
3.243 ms 1 Yes /classes/Product.php:6024
420
SELECT SQL_NO_CACHE c.`id_category`, cl.`name`
FROM `prstshp_category` c
INNER JOIN prstshp_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `prstshp_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
WHERE 1  AND `id_lang` = 2
AND c.`active` = 1
ORDER BY c.nleft, c.position
2.574 ms 97 Yes /classes/Category.php:710
173
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1378) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
2.358 ms 1 /classes/stock/StockAvailable.php:453
2
SELECT SQL_NO_CACHE c.`name`, cl.`id_lang`, IF(cl.`id_lang` IS NULL, c.`value`, cl.`value`) AS value, c.id_shop_group, c.id_shop
FROM `prstshp_configuration` c
LEFT JOIN `prstshp_configuration_lang` cl ON (c.`id_configuration` = cl.`id_configuration`)
2.008 ms 1360 /classes/Configuration.php:180
732
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 3307
ORDER BY `position`
1.836 ms 1 Yes /classes/Product.php:3539
93
SELECT SQL_NO_CACHE `id_hook`, `name`
FROM `prstshp_hook`
UNION
SELECT `id_hook`, ha.`alias` as name
FROM `prstshp_hook_alias` ha
INNER JOIN `prstshp_hook` h ON ha.name = h.name
1.757 ms 0 /classes/Hook.php:1348
177
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `prstshp_category_lang` cl
WHERE `id_lang` = 2
AND cl.id_shop = 1 
AND cl.`id_category` = 14 LIMIT 1
1.731 ms 1 /classes/Category.php:1373
269
SELECT SQL_NO_CACHE product_attribute_shop.`price`
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.`id_product_attribute` = 6946 LIMIT 1
1.575 ms 1 /classes/Combination.php:560
94
SELECT SQL_NO_CACHE h.id_hook, h.name as h_name, title, description, h.position, hm.position as hm_position, m.id_module, m.name, m.active
FROM `prstshp_hook_module` hm
STRAIGHT_JOIN `prstshp_hook` h ON (h.id_hook = hm.id_hook AND hm.id_shop = 1)
STRAIGHT_JOIN `prstshp_module` as m ON (m.id_module = hm.id_module)
ORDER BY hm.position
1.412 ms 516 /classes/Hook.php:455
415
SELECT SQL_NO_CACHE c.*, cl.*
FROM `prstshp_category` c
LEFT JOIN `prstshp_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 2 AND cl.id_shop = 1 )
WHERE `name` = 'PENJOLL'
AND c.`id_category` != 2
AND c.`id_parent` = 2 LIMIT 1
1.327 ms 3 /classes/Category.php:1492
434
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 3314) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.105 ms 1 /classes/stock/StockAvailable.php:453
13
SELECT SQL_NO_CACHE h.`name` as hook, m.`id_module`, h.`id_hook`, m.`name` as module
FROM `prstshp_module` m
INNER JOIN prstshp_module_shop module_shop
ON (module_shop.id_module = m.id_module AND module_shop.id_shop = 1 AND module_shop.enable_device & 1)
INNER JOIN `prstshp_hook_module` `hm` ON hm.`id_module` = m.`id_module`
INNER JOIN `prstshp_hook` `h` ON hm.`id_hook` = h.`id_hook`
LEFT JOIN `prstshp_module_group` `mg` ON mg.`id_module` = m.`id_module`
WHERE (h.`name` != "paymentOptions") AND (hm.`id_shop` = 1) AND (mg.id_shop = 1 AND  mg.`id_group` IN (1))
GROUP BY hm.id_hook, hm.id_module
ORDER BY hm.`position`
1.098 ms 112 Yes Yes /classes/Hook.php:1289
12
SELECT SQL_NO_CACHE lower(name) as name
FROM `prstshp_hook` h
WHERE (h.active = 1)
0.934 ms 1097 /classes/Hook.php:1388
423
SELECT SQL_NO_CACHE p.*,
ps.*,
pl.*,
sa.out_of_stock,
IFNULL(sa.quantity, 0) as quantity,
(DATEDIFF(
p.`date_add`,
DATE_SUB(
'2026-04-13 00:00:00',
INTERVAL 30 DAY
)
) > 0) as new
FROM prstshp_product p
LEFT JOIN prstshp_product_lang pl
ON pl.id_product = p.id_product
AND pl.id_shop = 1
AND pl.id_lang = 2
LEFT JOIN prstshp_stock_available sa   ON sa.id_product = p.id_product
AND sa.id_product_attribute = 0
AND sa.id_shop = 1 LEFT JOIN prstshp_product_shop ps
ON ps.id_product = p.id_product
AND ps.id_shop = 1
WHERE p.id_product IN (3314,3312,3310,3308,3307,3306,3305,3302,3300,3297,3296,3295,3293,3291,3265,3264,3262,3258,3211,3210,3209,3208,3207,3206)
0.918 ms 24 /classes/ProductAssembler.php:95
44
SELECT SQL_NO_CACHE * FROM `prstshp_image_type`
0.902 ms 8 /classes/ImageType.php:161
187
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1379 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1379 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.845 ms 0 /classes/Cart.php:1430
39
SELECT SQL_NO_CACHE c.*, cl.`id_lang`, cl.`name`, cl.`description`, cl.`additional_description`, cl.`link_rewrite`, cl.`meta_title`, cl.`meta_keywords`, cl.`meta_description`
FROM `prstshp_category` c
INNER JOIN prstshp_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `prstshp_category_lang` cl ON (c.`id_category` = cl.`id_category` AND `id_lang` = 2  AND cl.id_shop = 1 )
LEFT JOIN `prstshp_category_group` cg ON (cg.`id_category` = c.`id_category`)
WHERE `id_parent` = 2
AND `active` = 1
AND cg.`id_group` =1
GROUP BY c.`id_category`
ORDER BY `level_depth` ASC, category_shop.`position` ASC
0.843 ms 25 Yes Yes /classes/Category.php:916
414
SELECT SQL_NO_CACHE c.*, cl.*
FROM `prstshp_category` c
LEFT JOIN `prstshp_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 2 AND cl.id_shop = 1 )
WHERE `name` = 'ORO 14K'
AND c.`id_category` != 2
AND c.`id_parent` = 2 LIMIT 1
0.754 ms 3 /classes/Category.php:1492
262
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1418 AND `id_group` = 1 LIMIT 1
0.748 ms 0 /classes/GroupReduction.php:153
16
SELECT SQL_NO_CACHE `id_hook`, `name` FROM `prstshp_hook`
0.676 ms 1097 /classes/Hook.php:1348
176
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1379
AND image_shop.`cover` = 1 LIMIT 1
0.540 ms 2 /classes/Product.php:3570
411
SELECT SQL_NO_CACHE type, id_value, filter_show_limit, filter_type FROM prstshp_layered_category
WHERE controller = 'category'
AND id_category = 2
AND id_shop = 1
GROUP BY `type`, id_value ORDER BY position ASC
0.516 ms 2 Yes Yes /modules/ps_facetedsearch/src/Filters/Provider.php:57
495
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3306 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3306 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.507 ms 0 /classes/Cart.php:1430
279
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1420 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1420 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.504 ms 0 /classes/Cart.php:1430
268
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1420) AND (b.`id_shop` = 1) LIMIT 1
0.487 ms 1 /src/Adapter/EntityMapper.php:71
713
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 3206 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.481 ms 1 Yes /classes/SpecificPrice.php:576
806
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3314) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.477 ms 1 Yes /classes/Product.php:4513
182
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1379 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.476 ms 1 Yes /classes/SpecificPrice.php:576
701
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 3207 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.472 ms 1 Yes /classes/SpecificPrice.php:576
254
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1417 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1417 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.471 ms 0 /classes/Cart.php:1430
634
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 3258 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.471 ms 1 Yes /classes/SpecificPrice.php:576
454
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 3310 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.470 ms 1 Yes /classes/SpecificPrice.php:576
490
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 3306 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.468 ms 1 Yes /classes/SpecificPrice.php:576
471
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3308 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3308 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.467 ms 0 /classes/Cart.php:1430
90
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1365 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.463 ms 1 Yes /classes/SpecificPrice.php:576
647
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 3211 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.459 ms 1 Yes /classes/SpecificPrice.php:576
273
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1420 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.458 ms 1 Yes /classes/SpecificPrice.php:576
466
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 3308 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.456 ms 1 Yes /classes/SpecificPrice.php:576
223
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1410 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1410 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.454 ms 0 /classes/Cart.php:1430
432
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 3314 AND id_shop=1 LIMIT 1
0.452 ms 1 /classes/Product.php:6884
15
SELECT SQL_NO_CACHE m.page, ml.url_rewrite, ml.id_lang
FROM `prstshp_meta` m
LEFT JOIN `prstshp_meta_lang` ml ON (m.id_meta = ml.id_meta AND ml.id_shop = 1 )
ORDER BY LENGTH(ml.url_rewrite) DESC
0.448 ms 56 Yes /classes/Dispatcher.php:654
689
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 3208 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.447 ms 1 Yes /classes/SpecificPrice.php:576
478
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 3307 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.442 ms 1 Yes /classes/SpecificPrice.php:576
682
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3209 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3209 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.436 ms 0 /classes/Cart.php:1430
677
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 3209 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.434 ms 1 Yes /classes/SpecificPrice.php:576
807
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3312) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.434 ms 1 Yes /classes/Product.php:4513
639
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3258 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3258 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.431 ms 0 /classes/Cart.php:1430
189
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1382
AND image_shop.`cover` = 1 LIMIT 1
0.427 ms 1 /classes/Product.php:3570
694
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3208 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3208 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.427 ms 0 /classes/Cart.php:1430
652
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3211 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3211 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.423 ms 0 /classes/Cart.php:1430
102
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1365 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1365 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.420 ms 0 /classes/Cart.php:1430
670
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3210 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3210 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.418 ms 0 /classes/Cart.php:1430
502
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 3305 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.414 ms 1 Yes /classes/SpecificPrice.php:576
810
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3307) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.414 ms 1 Yes /classes/Product.php:4513
430
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 3314 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.408 ms 1 Yes /classes/SpecificPrice.php:576
266
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1420
AND image_shop.`cover` = 1 LIMIT 1
0.405 ms 1 /classes/Product.php:3570
829
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3211) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.404 ms 2 Yes /classes/Product.php:4513
157
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1377 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.404 ms 1 Yes /classes/SpecificPrice.php:576
610
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 3264 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.402 ms 1 Yes /classes/SpecificPrice.php:576
706
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3207 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3207 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.402 ms 0 /classes/Cart.php:1430
442
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 3312 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.399 ms 1 Yes /classes/SpecificPrice.php:576
162
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1377 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1377 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.399 ms 0 /classes/Cart.php:1430
244
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1416 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1416 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.396 ms 0 /classes/Cart.php:1430
821
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3264) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.396 ms 1 Yes /classes/Product.php:4513
531
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3300 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3300 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.395 ms 0 /classes/Cart.php:1430
816
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3296) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.394 ms 1 Yes /classes/Product.php:4513
808
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3310) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.394 ms 1 Yes /classes/Product.php:4513
718
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3206 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3206 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.393 ms 0 /classes/Cart.php:1430
357
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1430) AND (b.`id_shop` = 1) LIMIT 1
0.391 ms 1 /src/Adapter/EntityMapper.php:71
1
SELECT SQL_NO_CACHE gs.*, s.*, gs.name AS group_name, s.name AS shop_name, s.active, su.domain, su.domain_ssl, su.physical_uri, su.virtual_uri
FROM prstshp_shop_group gs
LEFT JOIN prstshp_shop s
ON s.id_shop_group = gs.id_shop_group
LEFT JOIN prstshp_shop_url su
ON s.id_shop = su.id_shop AND su.main = 1
WHERE s.deleted = 0
AND gs.deleted = 0
ORDER BY gs.name, s.name
0.389 ms 1 Yes /classes/shop/Shop.php:715
416
SELECT SQL_NO_CACHE c.*, cl.*
FROM `prstshp_category` c
LEFT JOIN `prstshp_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 2 AND cl.id_shop = 1 )
WHERE `name` = 'DIAMANTES DE LABORATORIO'
AND c.`id_category` != 2
AND c.`id_parent` = 2 LIMIT 1
0.388 ms 3 /classes/Category.php:1492
199
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1382 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1382 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.383 ms 0 /classes/Cart.php:1430
483
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3307 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3307 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.380 ms 0 /classes/Cart.php:1430
809
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3308) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.380 ms 1 Yes /classes/Product.php:4513
514
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 3302 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.380 ms 1 Yes /classes/SpecificPrice.php:576
218
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1410 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.379 ms 1 Yes /classes/SpecificPrice.php:576
538
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 3297 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.379 ms 1 Yes /classes/SpecificPrice.php:576
318
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `prstshp_attribute` a
LEFT JOIN `prstshp_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 2)
LEFT JOIN `prstshp_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `prstshp_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 2)
LEFT JOIN `prstshp_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 2)
WHERE pa.`id_product` = 1424
AND pac.`id_product_attribute` = 1830
AND agl.`id_lang` = 2
0.378 ms 2 /classes/Product.php:7528
814
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3300) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.377 ms 1 Yes /classes/Product.php:4513
819
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3291) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.377 ms 1 Yes /classes/Product.php:4513
831
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3209) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.376 ms 1 Yes /classes/Product.php:4513
813
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3302) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.375 ms 1 Yes /classes/Product.php:4513
591
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3291 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3291 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.375 ms 0 /classes/Cart.php:1430
822
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3262) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.373 ms 1 Yes /classes/Product.php:4513
830
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3210) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.373 ms 1 Yes /classes/Product.php:4513
347
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1428 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1428 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.372 ms 0 /classes/Cart.php:1430
643
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3211) AND (b.`id_shop` = 1) LIMIT 1
0.372 ms 1 /src/Adapter/EntityMapper.php:71
18
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `prstshp_module` m
LEFT JOIN `prstshp_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
0.370 ms 102 /classes/module/Module.php:341
384
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1436 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.370 ms 1 Yes /classes/SpecificPrice.php:576
615
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3264 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3264 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.370 ms 0 /classes/Cart.php:1430
296
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1421 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1421 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.370 ms 0 /classes/Cart.php:1430
459
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3310 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3310 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.369 ms 0 /classes/Cart.php:1430
815
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3297) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.369 ms 1 Yes /classes/Product.php:4513
832
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3208) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.369 ms 1 Yes /classes/Product.php:4513
393
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1462) AND (b.`id_shop` = 1) LIMIT 1
0.367 ms 1 /src/Adapter/EntityMapper.php:71
555
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3296 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3296 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.367 ms 0 /classes/Cart.php:1430
519
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3302 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3302 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.367 ms 0 /classes/Cart.php:1430
833
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3207) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.367 ms 1 Yes /classes/Product.php:4513
811
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3306) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.364 ms 1 Yes /classes/Product.php:4513
507
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3305 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3305 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.363 ms 0 /classes/Cart.php:1430
377
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1435 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1435 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.362 ms 0 /classes/Cart.php:1430
567
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3295 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3295 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.362 ms 0 /classes/Cart.php:1430
562
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 3295 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.362 ms 1 Yes /classes/SpecificPrice.php:576
574
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 3293 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.361 ms 1 Yes /classes/SpecificPrice.php:576
108
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1370) AND (b.`id_shop` = 1) LIMIT 1
0.360 ms 1 /src/Adapter/EntityMapper.php:71
550
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 3296 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.360 ms 1 Yes /classes/SpecificPrice.php:576
823
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3258) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.360 ms 1 Yes /classes/Product.php:4513
526
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 3300 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.359 ms 1 Yes /classes/SpecificPrice.php:576
284
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `prstshp_attribute` a
LEFT JOIN `prstshp_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 2)
LEFT JOIN `prstshp_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `prstshp_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 2)
LEFT JOIN `prstshp_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 2)
WHERE pa.`id_product` = 1420
AND pac.`id_product_attribute` = 6946
AND agl.`id_lang` = 2
0.358 ms 2 /classes/Product.php:7528
400
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1462 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1462 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.358 ms 0 /classes/Cart.php:1430
812
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3305) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.358 ms 1 Yes /classes/Product.php:4513
586
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 3291 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.357 ms 1 Yes /classes/SpecificPrice.php:576
820
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3265) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.357 ms 1 Yes /classes/Product.php:4513
543
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3297 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3297 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.353 ms 0 /classes/Cart.php:1430
206
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1398 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.351 ms 1 Yes /classes/SpecificPrice.php:576
360
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1430 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.351 ms 1 Yes /classes/SpecificPrice.php:576
834
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3206) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.351 ms 1 Yes /classes/Product.php:4513
628
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3262
ORDER BY f.position ASC
0.350 ms 1 Yes /classes/Product.php:6024
698
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3207) AND (b.`id_shop` = 1) LIMIT 1
0.349 ms 1 /src/Adapter/EntityMapper.php:71
372
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1435 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.349 ms 1 Yes /classes/SpecificPrice.php:576
365
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1430 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1430 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.348 ms 0 /classes/Cart.php:1430
818
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3293) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.348 ms 1 Yes /classes/Product.php:4513
389
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1436 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1436 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.347 ms 0 /classes/Cart.php:1430
817
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3295) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
0.346 ms 1 Yes /classes/Product.php:4513
211
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1398 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1398 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.345 ms 0 /classes/Cart.php:1430
255
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1417
ORDER BY f.position ASC
0.345 ms 1 Yes /classes/Product.php:6024
179
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1379) AND (b.`id_shop` = 1) LIMIT 1
0.345 ms 1 /src/Adapter/EntityMapper.php:71
710
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3206) AND (b.`id_shop` = 1) LIMIT 1
0.345 ms 1 /src/Adapter/EntityMapper.php:71
435
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3314 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3314 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.344 ms 0 /classes/Cart.php:1430
330
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1426 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1426 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.344 ms 0 /classes/Cart.php:1430
234
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1414 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1414 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.343 ms 0 /classes/Cart.php:1430
622
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 3262 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.342 ms 1 Yes /classes/SpecificPrice.php:576
194
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1382 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.340 ms 1 Yes /classes/SpecificPrice.php:576
657
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `prstshp_attribute` a
LEFT JOIN `prstshp_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 2)
LEFT JOIN `prstshp_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `prstshp_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 2)
LEFT JOIN `prstshp_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 2)
WHERE pa.`id_product` = 3211
AND pac.`id_product_attribute` = 3880
AND agl.`id_lang` = 2
0.340 ms 2 /classes/Product.php:7528
264
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1418 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1418 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.339 ms 0 /classes/Cart.php:1430
598
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 3265 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.338 ms 1 Yes /classes/SpecificPrice.php:576
439
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3312) AND (b.`id_shop` = 1) LIMIT 1
0.336 ms 1 /src/Adapter/EntityMapper.php:71
707
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3207
ORDER BY f.position ASC
0.336 ms 1 Yes /classes/Product.php:6024
281
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 6946
AND cp.`id_cart` = 0 AND cp.`id_product` = 1420 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 6946
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1420 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.334 ms 0 /classes/Cart.php:1430
298
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 1800
AND cp.`id_cart` = 0 AND cp.`id_product` = 1421 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 1800
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1421 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.332 ms 0 /classes/Cart.php:1430
671
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3210
ORDER BY f.position ASC
0.332 ms 1 Yes /classes/Product.php:6024
313
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1424 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1424 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.331 ms 0 /classes/Cart.php:1430
627
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3262 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3262 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.330 ms 0 /classes/Cart.php:1430
674
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3209) AND (b.`id_shop` = 1) LIMIT 1
0.330 ms 1 /src/Adapter/EntityMapper.php:71
277
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1420 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.328 ms 1 Yes /classes/SpecificPrice.php:576
103
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1365
ORDER BY f.position ASC
0.327 ms 1 Yes /classes/Product.php:6024
686
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3208) AND (b.`id_shop` = 1) LIMIT 1
0.325 ms 1 /src/Adapter/EntityMapper.php:71
332
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 1832
AND cp.`id_cart` = 0 AND cp.`id_product` = 1426 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 1832
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1426 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.324 ms 0 /classes/Cart.php:1430
335
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `prstshp_attribute` a
LEFT JOIN `prstshp_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 2)
LEFT JOIN `prstshp_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `prstshp_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 2)
LEFT JOIN `prstshp_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 2)
WHERE pa.`id_product` = 1426
AND pac.`id_product_attribute` = 1832
AND agl.`id_lang` = 2
0.324 ms 2 /classes/Product.php:7528
447
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3312 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3312 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.324 ms 0 /classes/Cart.php:1430
126
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1373 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1373 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.322 ms 0 /classes/Cart.php:1430
475
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3307) AND (b.`id_shop` = 1) LIMIT 1
0.321 ms 1 /src/Adapter/EntityMapper.php:71
405
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `prstshp_attribute` a
LEFT JOIN `prstshp_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 2)
LEFT JOIN `prstshp_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `prstshp_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 2)
LEFT JOIN `prstshp_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 2)
WHERE pa.`id_product` = 1462
AND pac.`id_product_attribute` = 1841
AND agl.`id_lang` = 2
0.321 ms 2 /classes/Product.php:7528
402
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 1841
AND cp.`id_cart` = 0 AND cp.`id_product` = 1462 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 1841
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1462 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.318 ms 0 /classes/Cart.php:1430
631
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3258) AND (b.`id_shop` = 1) LIMIT 1
0.317 ms 1 /src/Adapter/EntityMapper.php:71
145
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1375 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.316 ms 1 Yes /classes/SpecificPrice.php:576
665
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 3210 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.316 ms 1 Yes /classes/SpecificPrice.php:576
499
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3305) AND (b.`id_shop` = 1) LIMIT 1
0.315 ms 1 /src/Adapter/EntityMapper.php:71
451
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3310) AND (b.`id_shop` = 1) LIMIT 1
0.315 ms 1 /src/Adapter/EntityMapper.php:71
133
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1374 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.314 ms 1 Yes /classes/SpecificPrice.php:576
289
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1421) AND (b.`id_shop` = 1) LIMIT 1
0.313 ms 1 /src/Adapter/EntityMapper.php:71
323
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1426) AND (b.`id_shop` = 1) LIMIT 1
0.313 ms 1 /src/Adapter/EntityMapper.php:71
169
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1378 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.311 ms 1 Yes /classes/SpecificPrice.php:576
579
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3293 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3293 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.310 ms 0 /classes/Cart.php:1430
121
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1373 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.309 ms 1 Yes /classes/SpecificPrice.php:576
174
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1378 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1378 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.309 ms 0 /classes/Cart.php:1430
191
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1382) AND (b.`id_shop` = 1) LIMIT 1
0.308 ms 1 /src/Adapter/EntityMapper.php:71
349
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 1834
AND cp.`id_cart` = 0 AND cp.`id_product` = 1428 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 1834
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1428 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.308 ms 0 /classes/Cart.php:1430
315
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 1830
AND cp.`id_cart` = 0 AND cp.`id_product` = 1424 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 1830
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1424 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.307 ms 0 /classes/Cart.php:1430
245
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1416
ORDER BY f.position ASC
0.306 ms 1 Yes /classes/Product.php:6024
654
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 3880
AND cp.`id_cart` = 0 AND cp.`id_product` = 3211 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 3880
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3211 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.306 ms 0 /classes/Cart.php:1430
352
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `prstshp_attribute` a
LEFT JOIN `prstshp_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 2)
LEFT JOIN `prstshp_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `prstshp_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 2)
LEFT JOIN `prstshp_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 2)
WHERE pa.`id_product` = 1428
AND pac.`id_product_attribute` = 1834
AND agl.`id_lang` = 2
0.305 ms 2 /classes/Product.php:7528
695
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3208
ORDER BY f.position ASC
0.305 ms 1 Yes /classes/Product.php:6024
683
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3209
ORDER BY f.position ASC
0.303 ms 1 Yes /classes/Product.php:6024
640
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3258
ORDER BY f.position ASC
0.303 ms 1 Yes /classes/Product.php:6024
603
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3265 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3265 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.302 ms 0 /classes/Cart.php:1430
484
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3307
ORDER BY f.position ASC
0.299 ms 1 Yes /classes/Product.php:6024
301
SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `prstshp_attribute` a
LEFT JOIN `prstshp_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 2)
LEFT JOIN `prstshp_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `prstshp_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 2)
LEFT JOIN `prstshp_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 2)
WHERE pa.`id_product` = 1421
AND pac.`id_product_attribute` = 1800
AND agl.`id_lang` = 2
0.299 ms 2 /classes/Product.php:7528
487
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3306) AND (b.`id_shop` = 1) LIMIT 1
0.297 ms 1 /src/Adapter/EntityMapper.php:71
719
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3206
ORDER BY f.position ASC
0.297 ms 1 Yes /classes/Product.php:6024
19
SELECT SQL_NO_CACHE name, alias FROM `prstshp_hook_alias`
0.295 ms 88 /classes/Hook.php:342
238
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1416) AND (b.`id_shop` = 1) LIMIT 1
0.295 ms 1 /src/Adapter/EntityMapper.php:71
845
SELECT SQL_NO_CACHE m.* FROM `prstshp_module` m
0.295 ms 102 /classes/module/Module.php:1724
188
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1379
ORDER BY f.position ASC
0.294 ms 1 Yes /classes/Product.php:6024
568
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3295
ORDER BY f.position ASC
0.292 ms 1 Yes /classes/Product.php:6024
381
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1436) AND (b.`id_shop` = 1) LIMIT 1
0.291 ms 1 /src/Adapter/EntityMapper.php:71
460
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3310
ORDER BY f.position ASC
0.291 ms 1 Yes /classes/Product.php:6024
607
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3264) AND (b.`id_shop` = 1) LIMIT 1
0.290 ms 1 /src/Adapter/EntityMapper.php:71
150
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1375 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1375 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.290 ms 0 /classes/Cart.php:1430
437
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3312
AND image_shop.`cover` = 1 LIMIT 1
0.290 ms 1 /classes/Product.php:3570
616
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3264
ORDER BY f.position ASC
0.290 ms 1 Yes /classes/Product.php:6024
369
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1435) AND (b.`id_shop` = 1) LIMIT 1
0.289 ms 1 /src/Adapter/EntityMapper.php:71
535
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3297) AND (b.`id_shop` = 1) LIMIT 1
0.289 ms 1 /src/Adapter/EntityMapper.php:71
595
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3265) AND (b.`id_shop` = 1) LIMIT 1
0.289 ms 1 /src/Adapter/EntityMapper.php:71
139
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1374
ORDER BY f.position ASC
0.288 ms 1 Yes /classes/Product.php:6024
248
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1417) AND (b.`id_shop` = 1) LIMIT 1
0.288 ms 1 /src/Adapter/EntityMapper.php:71
413
SELECT SQL_NO_CACHE c.*, cl.*
FROM `prstshp_category` c
LEFT JOIN `prstshp_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 2 AND cl.id_shop = 1 )
WHERE `name` = 'JOYAS PERSONALIZADAS ORO'
AND c.`id_category` != 2
AND c.`id_parent` = 2 LIMIT 1
0.287 ms 3 /classes/Category.php:1492
532
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3300
ORDER BY f.position ASC
0.287 ms 1 Yes /classes/Product.php:6024
547
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3296) AND (b.`id_shop` = 1) LIMIT 1
0.285 ms 1 /src/Adapter/EntityMapper.php:71
215
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1410) AND (b.`id_shop` = 1) LIMIT 1
0.283 ms 1 /src/Adapter/EntityMapper.php:71
200
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1382
ORDER BY f.position ASC
0.282 ms 1 Yes /classes/Product.php:6024
571
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3293) AND (b.`id_shop` = 1) LIMIT 1
0.282 ms 1 /src/Adapter/EntityMapper.php:71
95
SELECT SQL_NO_CACHE tr.*
FROM `prstshp_tax_rule` tr
JOIN `prstshp_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 6
AND tr.`id_tax_rules_group` = 53
AND tr.`id_state` IN (0, 362)
AND ('08720' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '08720')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.282 ms 2 /classes/tax/TaxRulesTaxManager.php:100
228
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1414) AND (b.`id_shop` = 1) LIMIT 1
0.281 ms 1 /src/Adapter/EntityMapper.php:71
138
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1374 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1374 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.280 ms 0 /classes/Cart.php:1430
496
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3306
ORDER BY f.position ASC
0.280 ms 1 Yes /classes/Product.php:6024
511
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3302) AND (b.`id_shop` = 1) LIMIT 1
0.280 ms 1 /src/Adapter/EntityMapper.php:71
258
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1418) AND (b.`id_shop` = 1) LIMIT 1
0.279 ms 1 /src/Adapter/EntityMapper.php:71
559
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3295) AND (b.`id_shop` = 1) LIMIT 1
0.279 ms 1 /src/Adapter/EntityMapper.php:71
828
SELECT SQL_NO_CACHE pac.id_product_attribute, GROUP_CONCAT(agl.`name`, ' - ',al.`name` ORDER BY agl.`id_attribute_group` SEPARATOR ', ') as attribute_designation
FROM `prstshp_product_attribute_combination` pac
LEFT JOIN `prstshp_attribute` a ON a.`id_attribute` = pac.`id_attribute`
LEFT JOIN `prstshp_attribute_group` ag ON ag.`id_attribute_group` = a.`id_attribute_group`
LEFT JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
LEFT JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 2)
WHERE pac.id_product_attribute IN (3880)
GROUP BY pac.id_product_attribute
ORDER BY pac.id_product_attribute
0.278 ms 2 /classes/Product.php:2746
583
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3291) AND (b.`id_shop` = 1) LIMIT 1
0.277 ms 1 /src/Adapter/EntityMapper.php:71
166
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1378) AND (b.`id_shop` = 1) LIMIT 1
0.277 ms 1 /src/Adapter/EntityMapper.php:71
114
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1370 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1370 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.276 ms 0 /classes/Cart.php:1430
340
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1428) AND (b.`id_shop` = 1) LIMIT 1
0.276 ms 1 /src/Adapter/EntityMapper.php:71
523
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3300) AND (b.`id_shop` = 1) LIMIT 1
0.276 ms 1 /src/Adapter/EntityMapper.php:71
154
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1377) AND (b.`id_shop` = 1) LIMIT 1
0.276 ms 1 /src/Adapter/EntityMapper.php:71
306
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1424) AND (b.`id_shop` = 1) LIMIT 1
0.274 ms 1 /src/Adapter/EntityMapper.php:71
544
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3297
ORDER BY f.position ASC
0.274 ms 1 Yes /classes/Product.php:6024
54
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 87) AND (b.`id_shop` = 1) LIMIT 1
0.273 ms 1 /src/Adapter/EntityMapper.php:71
827
SELECT SQL_NO_CACHE pa.*, product_attribute_shop.*
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.`id_product` = 3211
GROUP BY pa.`id_product_attribute`
ORDER BY pa.`id_product_attribute`
0.270 ms 2 Yes Yes /classes/Product.php:2731
203
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1398) AND (b.`id_shop` = 1) LIMIT 1
0.269 ms 1 /src/Adapter/EntityMapper.php:71
390
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1436
ORDER BY f.position ASC
0.268 ms 1 Yes /classes/Product.php:6024
366
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1430
ORDER BY f.position ASC
0.268 ms 1 Yes /classes/Product.php:6024
224
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1410
ORDER BY f.position ASC
0.267 ms 1 Yes /classes/Product.php:6024
508
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3305
ORDER BY f.position ASC
0.267 ms 1 Yes /classes/Product.php:6024
592
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3291
ORDER BY f.position ASC
0.267 ms 1 Yes /classes/Product.php:6024
412
SELECT SQL_NO_CACHE c.*, cl.*
FROM `prstshp_category` c
LEFT JOIN `prstshp_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 2 AND cl.id_shop = 1 )
WHERE `name` = 'JOYAS DE PLATA'
AND c.`id_category` != 2
AND c.`id_parent` = 2 LIMIT 1
0.267 ms 2 /classes/Category.php:1492
351
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1428
ORDER BY f.position ASC
0.266 ms 1 Yes /classes/Product.php:6024
656
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3211
ORDER BY f.position ASC
0.265 ms 1 Yes /classes/Product.php:6024
750
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 3296
ORDER BY `position`
0.264 ms 1 Yes /classes/Product.php:3539
130
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1374) AND (b.`id_shop` = 1) LIMIT 1
0.264 ms 1 /src/Adapter/EntityMapper.php:71
648
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3211)
0.264 ms 1 /classes/Product.php:3860
378
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1435
ORDER BY f.position ASC
0.263 ms 1 Yes /classes/Product.php:6024
436
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3314
ORDER BY f.position ASC
0.263 ms 1 Yes /classes/Product.php:6024
520
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3302
ORDER BY f.position ASC
0.262 ms 1 Yes /classes/Product.php:6024
556
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3296
ORDER BY f.position ASC
0.261 ms 1 Yes /classes/Product.php:6024
271
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE `id_product_attribute` != 0 LIMIT 1
0.261 ms 2 /classes/SpecificPrice.php:297
334
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1426
ORDER BY f.position ASC
0.258 ms 1 Yes /classes/Product.php:6024
446
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 3312) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.256 ms 1 /classes/stock/StockAvailable.php:453
678
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3209)
0.256 ms 1 /classes/Product.php:3860
0
SELECT SQL_NO_CACHE s.id_shop, CONCAT(su.physical_uri, su.virtual_uri) AS uri, su.domain, su.main
FROM prstshp_shop_url su
LEFT JOIN prstshp_shop s ON (s.id_shop = su.id_shop)
WHERE (su.domain = 'www.joieriaorfi.es' OR su.domain_ssl = 'www.joieriaorfi.es')
AND s.active = 1
AND s.deleted = 0
ORDER BY LENGTH(CONCAT(su.physical_uri, su.virtual_uri)) DESC
0.255 ms 1 Yes /classes/shop/Shop.php:1364
11
SELECT SQL_NO_CACHE COUNT(DISTINCT l.id_lang) FROM `prstshp_lang` l
JOIN prstshp_lang_shop lang_shop ON (lang_shop.id_lang = l.id_lang AND lang_shop.id_shop = 1)
WHERE l.`active` = 1 LIMIT 1
0.254 ms 4 /classes/Language.php:1214
404
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1462
ORDER BY f.position ASC
0.254 ms 1 Yes /classes/Product.php:6024
300
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1421
ORDER BY f.position ASC
0.253 ms 1 Yes /classes/Product.php:6024
455
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3310)
0.252 ms 1 /classes/Product.php:3860
83
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1365) AND (b.`id_shop` = 1) LIMIT 1
0.251 ms 1 /src/Adapter/EntityMapper.php:71
235
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1414
ORDER BY f.position ASC
0.251 ms 1 Yes /classes/Product.php:6024
448
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3312
ORDER BY f.position ASC
0.250 ms 1 Yes /classes/Product.php:6024
212
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1398
ORDER BY f.position ASC
0.247 ms 1 Yes /classes/Product.php:6024
80
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1365
AND image_shop.`cover` = 1 LIMIT 1
0.246 ms 1 /classes/Product.php:3570
104
SELECT SQL_NO_CACHE tr.*
FROM `prstshp_tax_rule` tr
JOIN `prstshp_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 6
AND tr.`id_tax_rules_group` = 53
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.245 ms 1 /classes/tax/TaxRulesTaxManager.php:100
265
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1418
ORDER BY f.position ASC
0.244 ms 1 Yes /classes/Product.php:6024
142
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1375) AND (b.`id_shop` = 1) LIMIT 1
0.244 ms 1 /src/Adapter/EntityMapper.php:71
163
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1377
ORDER BY f.position ASC
0.244 ms 1 Yes /classes/Product.php:6024
283
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1420
ORDER BY f.position ASC
0.244 ms 1 Yes /classes/Product.php:6024
619
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3262) AND (b.`id_shop` = 1) LIMIT 1
0.243 ms 1 /src/Adapter/EntityMapper.php:71
426
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3314) AND (b.`id_shop` = 1) LIMIT 1
0.240 ms 1 /src/Adapter/EntityMapper.php:71
317
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1424
ORDER BY f.position ASC
0.240 ms 1 Yes /classes/Product.php:6024
56
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 112) AND (b.`id_shop` = 1) LIMIT 1
0.239 ms 1 /src/Adapter/EntityMapper.php:71
190
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.239 ms 1 /classes/Product.php:5670
702
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3207)
0.238 ms 1 /classes/Product.php:3860
735
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 3306
ORDER BY `position`
0.236 ms 1 Yes /classes/Product.php:3539
794
SELECT SQL_NO_CACHE 1 FROM `prstshp_cart_rule` WHERE ((date_to >= "2026-04-13 00:00:00" AND date_to <= "2026-04-13 23:59:59") OR (date_from >= "2026-04-13 00:00:00" AND date_from <= "2026-04-13 23:59:59") OR (date_from < "2026-04-13 00:00:00" AND date_to > "2026-04-13 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
0.234 ms 7 /classes/CartRule.php:357
91
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1365)
0.233 ms 1 /classes/Product.php:3860
452
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 3310 LIMIT 1
0.233 ms 1 /classes/SpecificPrice.php:435
662
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3210) AND (b.`id_shop` = 1) LIMIT 1
0.233 ms 1 /src/Adapter/EntityMapper.php:71
467
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3308)
0.232 ms 1 /classes/Product.php:3860
714
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3206)
0.232 ms 1 /classes/Product.php:3860
118
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1373) AND (b.`id_shop` = 1) LIMIT 1
0.231 ms 1 /src/Adapter/EntityMapper.php:71
690
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3208)
0.231 ms 1 /classes/Product.php:3860
151
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1375
ORDER BY f.position ASC
0.230 ms 1 Yes /classes/Product.php:6024
604
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3265
ORDER BY f.position ASC
0.230 ms 1 Yes /classes/Product.php:6024
396
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1462)
0.229 ms 1 /classes/Product.php:3860
463
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3308) AND (b.`id_shop` = 1) LIMIT 1
0.229 ms 1 /src/Adapter/EntityMapper.php:71
408
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a0
LEFT JOIN `prstshp_category_lang` `a1` ON (a0.`id_category` = a1.`id_category`)
WHERE (a0.`nleft` < 2) AND (a0.`nright` > 197) AND (a1.`id_lang` = 2) AND (a1.`id_shop` = 1)
ORDER BY a0.`nleft` asc
0.228 ms 1 /classes/PrestaShopCollection.php:383
274
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1420)
0.224 ms 1 /classes/Product.php:3860
175
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1378
ORDER BY f.position ASC
0.224 ms 1 Yes /classes/Product.php:6024
580
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3293
ORDER BY f.position ASC
0.222 ms 1 Yes /classes/Product.php:6024
443
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3312)
0.221 ms 1 /classes/Product.php:3860
115
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1370
ORDER BY f.position ASC
0.220 ms 1 Yes /classes/Product.php:6024
373
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1435)
0.220 ms 1 /classes/Product.php:3860
641
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3211
AND image_shop.`cover` = 1 LIMIT 1
0.220 ms 1 /classes/Product.php:3570
418
SELECT SQL_NO_CACHE data FROM prstshp_layered_filter_block WHERE hash="14e7206e5d2ec0d7bf3028471eb77ad5" LIMIT 1
0.219 ms 1 /modules/ps_facetedsearch/src/Filters/Block.php:185
20
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 2) AND (b.`id_shop` = 1) LIMIT 1
0.219 ms 1 /src/Adapter/EntityMapper.php:71
385
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1436)
0.219 ms 1 /classes/Product.php:3860
795
SELECT SQL_NO_CACHE 1 FROM `prstshp_cart_rule` WHERE ((date_to >= "2026-04-13 00:00:00" AND date_to <= "2026-04-13 23:59:59") OR (date_from >= "2026-04-13 00:00:00" AND date_from <= "2026-04-13 23:59:59") OR (date_from < "2026-04-13 00:00:00" AND date_to > "2026-04-13 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
0.219 ms 7 /classes/CartRule.php:357
127
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1373
ORDER BY f.position ASC
0.217 ms 1 Yes /classes/Product.php:6024
240
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1416)
0.217 ms 1 /classes/Product.php:3860
551
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3296)
0.216 ms 1 /classes/Product.php:3860
684
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3208
AND image_shop.`cover` = 1 LIMIT 1
0.216 ms 1 /classes/Product.php:3570
479
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3307)
0.215 ms 1 /classes/Product.php:3860
183
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1379)
0.214 ms 1 /classes/Product.php:3860
491
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3306)
0.214 ms 1 /classes/Product.php:3860
720
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 3314
ORDER BY `position`
0.214 ms 1 Yes /classes/Product.php:3539
343
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1428)
0.213 ms 1 /classes/Product.php:3860
25
SELECT SQL_NO_CACHE *
FROM `prstshp_currency` a
LEFT JOIN `prstshp_currency_lang` `b` ON a.`id_currency` = b.`id_currency` AND b.`id_lang` = 2
LEFT JOIN `prstshp_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 2) LIMIT 1
0.213 ms 1 /src/Adapter/EntityMapper.php:71
57
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 122) AND (b.`id_shop` = 1) LIMIT 1
0.213 ms 1 /src/Adapter/EntityMapper.php:71
71
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a0
LEFT JOIN `prstshp_category_lang` `a1` ON (a0.`id_category` = a1.`id_category`)
WHERE (a0.`nleft` < 2) AND (a0.`nright` > 197) AND (a1.`id_lang` = 2) AND (a1.`id_shop` = 1)
ORDER BY a0.`nleft` asc
0.213 ms 1 /classes/PrestaShopCollection.php:383
250
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1417)
0.213 ms 1 /classes/Product.php:3860
473
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3307
AND image_shop.`cover` = 1 LIMIT 1
0.213 ms 1 /classes/Product.php:3570
539
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3297)
0.212 ms 1 /classes/Product.php:3860
753
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 3295
ORDER BY `position`
0.212 ms 1 Yes /classes/Product.php:3539
143
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1375 LIMIT 1
0.209 ms 1 /classes/SpecificPrice.php:435
158
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1377)
0.208 ms 1 /classes/Product.php:3860
292
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1421)
0.208 ms 1 /classes/Product.php:3860
48
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 18) AND (b.`id_shop` = 1) LIMIT 1
0.208 ms 1 /src/Adapter/EntityMapper.php:71
611
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3264)
0.208 ms 1 /classes/Product.php:3860
587
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3291)
0.207 ms 1 /classes/Product.php:3860
449
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3310
AND image_shop.`cover` = 1 LIMIT 1
0.206 ms 1 /classes/Product.php:3570
236
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1416
AND image_shop.`cover` = 1 LIMIT 1
0.205 ms 1 /classes/Product.php:3570
326
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1426)
0.205 ms 1 /classes/Product.php:3860
503
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3305)
0.205 ms 1 /classes/Product.php:3860
599
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3265)
0.205 ms 1 /classes/Product.php:3860
672
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3209
AND image_shop.`cover` = 1 LIMIT 1
0.205 ms 2 /classes/Product.php:3570
260
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1418)
0.204 ms 1 /classes/Product.php:3860
361
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1430)
0.204 ms 1 /classes/Product.php:3860
738
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 3305
ORDER BY `position`
0.204 ms 1 Yes /classes/Product.php:3539
824
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3211) LIMIT 1
0.204 ms 1 /src/Adapter/EntityMapper.php:71
219
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1410)
0.202 ms 1 /classes/Product.php:3860
403
SELECT SQL_NO_CACHE pa.`available_date` FROM `prstshp_product` p LEFT JOIN `prstshp_product_attribute` pa ON (pa.`id_product` = p.`id_product`) INNER JOIN prstshp_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1) INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) WHERE p.`id_product` = 1462 AND pa.`id_product` = 1462 AND pa.`id_product_attribute` = 1841 LIMIT 1
0.202 ms 1 /classes/Product.php:1209
696
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3207
AND image_shop.`cover` = 1 LIMIT 1
0.202 ms 2 /classes/Product.php:3570
774
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 3211
ORDER BY `position`
0.202 ms 1 Yes /classes/Product.php:3539
635
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3258)
0.201 ms 1 /classes/Product.php:3860
744
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 3300
ORDER BY `position`
0.201 ms 1 Yes /classes/Product.php:3539
45
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 15) AND (b.`id_shop` = 1) LIMIT 1
0.200 ms 1 /src/Adapter/EntityMapper.php:71
309
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1424)
0.200 ms 1 /classes/Product.php:3860
431
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3314)
0.200 ms 1 /classes/Product.php:3860
195
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1382)
0.199 ms 1 /classes/Product.php:3860
515
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3302)
0.199 ms 1 /classes/Product.php:3860
76
SELECT SQL_NO_CACHE `id_configuration`
FROM `prstshp_configuration`
WHERE name = 'PS_ACCOUNTS_SHOP_STATUS'
AND (id_shop_group IS NULL OR id_shop_group = 0) AND (id_shop IS NULL OR id_shop = 0) LIMIT 1
0.199 ms 1 /classes/Configuration.php:133
777
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 3210
ORDER BY `position`
0.198 ms 1 Yes /classes/Product.php:3539
207
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1398)
0.198 ms 1 /classes/Product.php:3860
410
SELECT SQL_NO_CACHE `id_category`
FROM `prstshp_category_shop`
WHERE `id_category` = 2
AND `id_shop` = 1 LIMIT 1
0.198 ms 1 /classes/Category.php:2446
723
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 3312
ORDER BY `position`
0.197 ms 1 Yes /classes/Product.php:3539
741
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 3302
ORDER BY `position`
0.197 ms 1 Yes /classes/Product.php:3539
747
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 3297
ORDER BY `position`
0.197 ms 1 Yes /classes/Product.php:3539
105
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1370
AND image_shop.`cover` = 1 LIMIT 1
0.196 ms 1 /classes/Product.php:3570
113
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1370) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.196 ms 1 /classes/stock/StockAvailable.php:453
521
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3300
AND image_shop.`cover` = 1 LIMIT 1
0.196 ms 1 /classes/Product.php:3570
527
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3300)
0.196 ms 1 /classes/Product.php:3860
593
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3265
AND image_shop.`cover` = 1 LIMIT 1
0.196 ms 1 /classes/Product.php:3570
768
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 3262
ORDER BY `position`
0.196 ms 1 Yes /classes/Product.php:3539
152
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1377
AND image_shop.`cover` = 1 LIMIT 1
0.194 ms 1 /classes/Product.php:3570
563
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3295)
0.194 ms 1 /classes/Product.php:3860
533
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3297
AND image_shop.`cover` = 1 LIMIT 1
0.194 ms 1 /classes/Product.php:3570
78
SELECT SQL_NO_CACHE *
FROM `prstshp_configuration_lang`
WHERE `id_configuration` = 1315
0.192 ms 1 /src/Adapter/EntityMapper.php:79
58
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 113) AND (b.`id_shop` = 1) LIMIT 1
0.191 ms 1 /src/Adapter/EntityMapper.php:71
497
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3305
AND image_shop.`cover` = 1 LIMIT 1
0.191 ms 1 /classes/Product.php:3570
759
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 3291
ORDER BY `position`
0.191 ms 1 Yes /classes/Product.php:3539
230
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1414)
0.191 ms 1 /classes/Product.php:3860
59
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 115) AND (b.`id_shop` = 1) LIMIT 1
0.190 ms 1 /src/Adapter/EntityMapper.php:71
134
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1374)
0.190 ms 1 /classes/Product.php:3860
333
SELECT SQL_NO_CACHE pa.`available_date` FROM `prstshp_product` p LEFT JOIN `prstshp_product_attribute` pa ON (pa.`id_product` = p.`id_product`) INNER JOIN prstshp_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1) INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) WHERE p.`id_product` = 1426 AND pa.`id_product` = 1426 AND pa.`id_product_attribute` = 1832 LIMIT 1
0.190 ms 1 /classes/Product.php:1209
424
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3314
AND image_shop.`cover` = 1 LIMIT 1
0.190 ms 1 /classes/Product.php:3570
708
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3206
AND image_shop.`cover` = 1 LIMIT 1
0.190 ms 1 /classes/Product.php:3570
485
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3306
AND image_shop.`cover` = 1 LIMIT 1
0.189 ms 1 /classes/Product.php:3570
765
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 3264
ORDER BY `position`
0.189 ms 2 Yes /classes/Product.php:3539
406
SELECT SQL_NO_CACHE *
FROM `prstshp_product_attribute` a
LEFT JOIN `prstshp_product_attribute_shop` `c` ON a.`id_product_attribute` = c.`id_product_attribute` AND c.`id_shop` = 1
WHERE (a.`id_product_attribute` = 1841) LIMIT 1
0.189 ms 1 /src/Adapter/EntityMapper.php:71
617
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3262
AND image_shop.`cover` = 1 LIMIT 1
0.189 ms 1 /classes/Product.php:3570
771
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 3258
ORDER BY `position`
0.189 ms 2 Yes /classes/Product.php:3539
61
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 124) AND (b.`id_shop` = 1) LIMIT 1
0.188 ms 1 /src/Adapter/EntityMapper.php:71
170
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1378)
0.188 ms 1 /classes/Product.php:3860
734
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (3987) AND il.`id_lang` = 2 ORDER by i.`position`
0.188 ms 1 Yes /classes/Product.php:2915
756
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 3293
ORDER BY `position`
0.188 ms 1 Yes /classes/Product.php:3539
461
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3308
AND image_shop.`cover` = 1 LIMIT 1
0.187 ms 1 /classes/Product.php:3570
391
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1462
AND image_shop.`cover` = 1 LIMIT 1
0.186 ms 1 /classes/Product.php:3570
786
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 3207
ORDER BY `position`
0.186 ms 2 Yes /classes/Product.php:3539
40
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 96) AND (b.`id_shop` = 1) LIMIT 1
0.185 ms 1 /src/Adapter/EntityMapper.php:71
47
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 17) AND (b.`id_shop` = 1) LIMIT 1
0.185 ms 1 /src/Adapter/EntityMapper.php:71
52
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 79) AND (b.`id_shop` = 1) LIMIT 1
0.185 ms 1 /src/Adapter/EntityMapper.php:71
110
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1370)
0.185 ms 1 /classes/Product.php:3860
726
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 3310
ORDER BY `position`
0.185 ms 1 Yes /classes/Product.php:3539
755
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (3975) AND il.`id_lang` = 2 ORDER by i.`position`
0.185 ms 1 Yes /classes/Product.php:2915
780
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 3209
ORDER BY `position`
0.185 ms 2 Yes /classes/Product.php:3539
509
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3302
AND image_shop.`cover` = 1 LIMIT 1
0.184 ms 1 /classes/Product.php:3570
321
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1426
AND image_shop.`cover` = 1 LIMIT 1
0.184 ms 2 /classes/Product.php:3570
122
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1373)
0.183 ms 1 /classes/Product.php:3860
605
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3264
AND image_shop.`cover` = 1 LIMIT 1
0.183 ms 2 /classes/Product.php:3570
835
SELECT SQL_NO_CACHE * FROM prstshp_corewhatsapp WHERE core_status=1 AND FIND_IN_SET('2', `core_language`)  LIMIT 0,1
0.183 ms 1 /modules/corewhatsapp/corewhatsapp.php:169
6
SELECT SQL_NO_CACHE *
FROM `prstshp_country` a
LEFT JOIN `prstshp_country_lang` `b` ON a.`id_country` = b.`id_country` AND b.`id_lang` = 2
LEFT JOIN `prstshp_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 6) LIMIT 1
0.182 ms 1 /src/Adapter/EntityMapper.php:71
762
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 3265
ORDER BY `position`
0.182 ms 1 Yes /classes/Product.php:3539
379
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1436
AND image_shop.`cover` = 1 LIMIT 1
0.181 ms 1 /classes/Product.php:3570
101
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1365) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.181 ms 1 /classes/stock/StockAvailable.php:453
246
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1417
AND image_shop.`cover` = 1 LIMIT 1
0.181 ms 1 /classes/Product.php:3570
256
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1418
AND image_shop.`cover` = 1 LIMIT 1
0.181 ms 1 /classes/Product.php:3570
282
SELECT SQL_NO_CACHE pa.`available_date` FROM `prstshp_product` p LEFT JOIN `prstshp_product_attribute` pa ON (pa.`id_product` = p.`id_product`) INNER JOIN prstshp_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1) INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) WHERE p.`id_product` = 1420 AND pa.`id_product` = 1420 AND pa.`id_product_attribute` = 6946 LIMIT 1
0.181 ms 1 /classes/Product.php:1209
789
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 3206
ORDER BY `position`
0.181 ms 1 Yes /classes/Product.php:3539
53
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 86) AND (b.`id_shop` = 1) LIMIT 1
0.180 ms 1 /src/Adapter/EntityMapper.php:71
287
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1421
AND image_shop.`cover` = 1 LIMIT 1
0.180 ms 2 /classes/Product.php:3570
299
SELECT SQL_NO_CACHE pa.`available_date` FROM `prstshp_product` p LEFT JOIN `prstshp_product_attribute` pa ON (pa.`id_product` = p.`id_product`) INNER JOIN prstshp_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1) INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) WHERE p.`id_product` = 1421 AND pa.`id_product` = 1421 AND pa.`id_product_attribute` = 1800 LIMIT 1
0.179 ms 1 /classes/Product.php:1209
581
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3291
AND image_shop.`cover` = 1 LIMIT 1
0.179 ms 1 /classes/Product.php:3570
367
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1435
AND image_shop.`cover` = 1 LIMIT 1
0.178 ms 1 /classes/Product.php:3570
623
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3262)
0.178 ms 1 /classes/Product.php:3860
225
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1414
AND image_shop.`cover` = 1 LIMIT 1
0.178 ms 1 /classes/Product.php:3570
783
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 3208
ORDER BY `position`
0.178 ms 1 Yes /classes/Product.php:3539
729
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 3308
ORDER BY `position`
0.177 ms 1 Yes /classes/Product.php:3539
793
SELECT SQL_NO_CACHE 1 FROM prstshp_cart_product cp INNER JOIN prstshp_product p
ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps
ON (ps.id_shop = cp.id_shop AND ps.id_product = p.id_product) WHERE cp.id_cart=0 LIMIT 1
0.177 ms 1 /classes/Cart.php:4250
545
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3296
AND image_shop.`cover` = 1 LIMIT 1
0.176 ms 1 /classes/Product.php:3570
29
SELECT SQL_NO_CACHE *
FROM `prstshp_currency` a
LEFT JOIN `prstshp_currency_lang` `b` ON a.`id_currency` = b.`id_currency` AND b.`id_lang` = 2
LEFT JOIN `prstshp_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
0.176 ms 1 /src/Adapter/EntityMapper.php:71
51
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 68) AND (b.`id_shop` = 1) LIMIT 1
0.176 ms 1 /src/Adapter/EntityMapper.php:71
201
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1398
AND image_shop.`cover` = 1 LIMIT 1
0.176 ms 1 /classes/Product.php:3570
319
SELECT SQL_NO_CACHE *
FROM `prstshp_product_attribute` a
LEFT JOIN `prstshp_product_attribute_shop` `c` ON a.`id_product_attribute` = c.`id_product_attribute` AND c.`id_shop` = 1
WHERE (a.`id_product_attribute` = 1830) LIMIT 1
0.176 ms 1 /src/Adapter/EntityMapper.php:71
350
SELECT SQL_NO_CACHE pa.`available_date` FROM `prstshp_product` p LEFT JOIN `prstshp_product_attribute` pa ON (pa.`id_product` = p.`id_product`) INNER JOIN prstshp_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1) INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) WHERE p.`id_product` = 1428 AND pa.`id_product` = 1428 AND pa.`id_product_attribute` = 1834 LIMIT 1
0.176 ms 1 /classes/Product.php:1209
316
SELECT SQL_NO_CACHE pa.`available_date` FROM `prstshp_product` p LEFT JOIN `prstshp_product_attribute` pa ON (pa.`id_product` = p.`id_product`) INNER JOIN prstshp_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1) INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) WHERE p.`id_product` = 1424 AND pa.`id_product` = 1424 AND pa.`id_product_attribute` = 1830 LIMIT 1
0.175 ms 1 /classes/Product.php:1209
355
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1430
AND image_shop.`cover` = 1 LIMIT 1
0.175 ms 1 /classes/Product.php:3570
798
SELECT SQL_NO_CACHE COUNT(DISTINCT c.id_currency) FROM `prstshp_currency` c
LEFT JOIN prstshp_currency_shop cs ON (cs.id_currency = c.id_currency AND cs.id_shop = 1)
WHERE c.`active` = 1 AND c.`deleted` = 0 LIMIT 1
0.175 ms 2 /classes/Currency.php:1134
660
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3210
AND image_shop.`cover` = 1 LIMIT 1
0.174 ms 1 /classes/Product.php:3570
49
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 70) AND (b.`id_shop` = 1) LIMIT 1
0.173 ms 1 /src/Adapter/EntityMapper.php:71
302
SELECT SQL_NO_CACHE *
FROM `prstshp_product_attribute` a
LEFT JOIN `prstshp_product_attribute_shop` `c` ON a.`id_product_attribute` = c.`id_product_attribute` AND c.`id_shop` = 1
WHERE (a.`id_product_attribute` = 1800) LIMIT 1
0.173 ms 1 /src/Adapter/EntityMapper.php:71
164
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1378
AND image_shop.`cover` = 1 LIMIT 1
0.172 ms 1 /classes/Product.php:3570
100
SELECT SQL_NO_CACHE tr.*
FROM `prstshp_tax_rule` tr
JOIN `prstshp_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 6
AND tr.`id_tax_rules_group` = 0
AND tr.`id_state` IN (0, 362)
AND ('08720' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '08720')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.172 ms 0 /classes/tax/TaxRulesTaxManager.php:100
722
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (3994) AND il.`id_lang` = 2 ORDER by i.`position`
0.172 ms 1 Yes /classes/Product.php:2915
41
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 14) AND (b.`id_shop` = 1) LIMIT 1
0.171 ms 1 /src/Adapter/EntityMapper.php:71
285
SELECT SQL_NO_CACHE *
FROM `prstshp_product_attribute` a
LEFT JOIN `prstshp_product_attribute_shop` `c` ON a.`id_product_attribute` = c.`id_product_attribute` AND c.`id_shop` = 1
WHERE (a.`id_product_attribute` = 6946) LIMIT 1
0.171 ms 1 /src/Adapter/EntityMapper.php:71
304
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1424
AND image_shop.`cover` = 1 LIMIT 1
0.171 ms 2 /classes/Product.php:3570
338
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1428
AND image_shop.`cover` = 1 LIMIT 1
0.171 ms 2 /classes/Product.php:3570
557
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3295
AND image_shop.`cover` = 1 LIMIT 1
0.171 ms 1 /classes/Product.php:3570
4
SELECT SQL_NO_CACHE su.physical_uri, su.virtual_uri, su.domain, su.domain_ssl
FROM prstshp_shop s
LEFT JOIN prstshp_shop_url su ON (s.id_shop = su.id_shop)
WHERE s.id_shop = 1
AND s.active = 1 AND s.deleted = 0 AND su.main = 1 LIMIT 1
0.170 ms 1 /classes/shop/Shop.php:214
64
SELECT SQL_NO_CACHE * FROM `prstshp_image_type` WHERE 1 AND `products` = 1  ORDER BY `width` DESC, `height` DESC, `name`ASC
0.170 ms 8 Yes /classes/ImageType.php:109
213
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1410
AND image_shop.`cover` = 1 LIMIT 1
0.170 ms 1 /classes/Product.php:3570
575
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3293)
0.170 ms 1 /classes/Product.php:3860
43
SELECT SQL_NO_CACHE * FROM `prstshp_image_type` WHERE 1 AND `categories` = 1  ORDER BY `width` DESC, `height` DESC, `name`ASC
0.169 ms 8 Yes /classes/ImageType.php:109
60
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 117) AND (b.`id_shop` = 1) LIMIT 1
0.169 ms 1 /src/Adapter/EntityMapper.php:71
666
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3210)
0.169 ms 1 /classes/Product.php:3860
843
SELECT SQL_NO_CACHE `id_guest`
FROM `prstshp_connections`
WHERE `id_guest` = 3190
AND `date_add` > '2026-04-13 12:49:00'
AND id_shop IN (1) 
ORDER BY `date_add` DESC LIMIT 1
0.169 ms 1 Yes /classes/Connection.php:168
776
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (3879, 3880) AND il.`id_lang` = 2 ORDER by i.`position`
0.167 ms 1 Yes /classes/Product.php:2915
55
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 93) AND (b.`id_shop` = 1) LIMIT 1
0.166 ms 1 /src/Adapter/EntityMapper.php:71
336
SELECT SQL_NO_CACHE *
FROM `prstshp_product_attribute` a
LEFT JOIN `prstshp_product_attribute_shop` `c` ON a.`id_product_attribute` = c.`id_product_attribute` AND c.`id_shop` = 1
WHERE (a.`id_product_attribute` = 1832) LIMIT 1
0.166 ms 1 /src/Adapter/EntityMapper.php:71
440
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 3312 LIMIT 1
0.166 ms 1 /classes/SpecificPrice.php:435
458
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 3310) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.166 ms 1 /classes/stock/StockAvailable.php:453
50
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 59) AND (b.`id_shop` = 1) LIMIT 1
0.165 ms 1 /src/Adapter/EntityMapper.php:71
394
SELECT SQL_NO_CACHE product_attribute_shop.`price`
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.`id_product_attribute` = 1841 LIMIT 1
0.165 ms 1 /classes/Combination.php:560
450
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.164 ms 1 /classes/Product.php:5670
655
SELECT SQL_NO_CACHE pa.`available_date` FROM `prstshp_product` p LEFT JOIN `prstshp_product_attribute` pa ON (pa.`id_product` = p.`id_product`) INNER JOIN prstshp_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1) INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) WHERE p.`id_product` = 3211 AND pa.`id_product` = 3211 AND pa.`id_product_attribute` = 3880 LIMIT 1
0.164 ms 1 /classes/Product.php:1209
5
SELECT SQL_NO_CACHE l.*, ls.`id_shop`
FROM `prstshp_lang` l
LEFT JOIN `prstshp_lang_shop` ls ON (l.id_lang = ls.id_lang)
0.163 ms 2 /classes/Language.php:1080
644
SELECT SQL_NO_CACHE product_attribute_shop.`price`
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.`id_product_attribute` = 3880 LIMIT 1
0.163 ms 1 /classes/Combination.php:560
46
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 16) AND (b.`id_shop` = 1) LIMIT 1
0.162 ms 1 /src/Adapter/EntityMapper.php:71
620
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 3262 LIMIT 1
0.162 ms 1 /classes/SpecificPrice.php:435
629
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3258
AND image_shop.`cover` = 1 LIMIT 1
0.161 ms 2 /classes/Product.php:3570
31
SELECT SQL_NO_CACHE *
FROM `prstshp_currency` a
LEFT JOIN `prstshp_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 2) LIMIT 1
0.160 ms 1 /src/Adapter/EntityMapper.php:71
358
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1430 LIMIT 1
0.160 ms 1 /classes/SpecificPrice.php:435
476
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 3307 LIMIT 1
0.159 ms 1 /classes/SpecificPrice.php:435
494
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 3306) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.159 ms 1 /classes/stock/StockAvailable.php:453
518
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 3302) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.159 ms 1 /classes/stock/StockAvailable.php:453
596
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 3265 LIMIT 1
0.159 ms 1 /classes/SpecificPrice.php:435
728
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (3990) AND il.`id_lang` = 2 ORDER by i.`position`
0.159 ms 1 Yes /classes/Product.php:2915
14
SELECT SQL_NO_CACHE `name`, `alias` FROM `prstshp_hook_alias`
0.158 ms 88 /classes/Hook.php:290
75
SELECT SQL_NO_CACHE value FROM `prstshp_configuration` WHERE `name` = "PS_MULTISHOP_FEATURE_ACTIVE" LIMIT 1
0.158 ms 1 /modules/ps_accounts/src/Adapter/Configuration.php:278
146
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1375)
0.158 ms 1 /classes/Product.php:3860
353
SELECT SQL_NO_CACHE *
FROM `prstshp_product_attribute` a
LEFT JOIN `prstshp_product_attribute_shop` `c` ON a.`id_product_attribute` = c.`id_product_attribute` AND c.`id_shop` = 1
WHERE (a.`id_product_attribute` = 1834) LIMIT 1
0.158 ms 1 /src/Adapter/EntityMapper.php:71
632
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 3258 LIMIT 1
0.158 ms 1 /classes/SpecificPrice.php:435
388
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1436) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.158 ms 1 /classes/stock/StockAvailable.php:453
740
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (3985) AND il.`id_lang` = 2 ORDER by i.`position`
0.156 ms 1 Yes /classes/Product.php:2915
263
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1418) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.156 ms 1 /classes/stock/StockAvailable.php:453
711
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 3206 LIMIT 1
0.155 ms 1 /classes/SpecificPrice.php:435
752
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (3976) AND il.`id_lang` = 2 ORDER by i.`position`
0.155 ms 1 Yes /classes/Product.php:2915
791
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (3874) AND il.`id_lang` = 2 ORDER by i.`position`
0.153 ms 1 Yes /classes/Product.php:2915
761
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (3971) AND il.`id_lang` = 2 ORDER by i.`position`
0.152 ms 1 Yes /classes/Product.php:2915
21
SELECT SQL_NO_CACHE * FROM `prstshp_currency` c ORDER BY `iso_code` ASC
0.151 ms 2 Yes /classes/Currency.php:708
307
SELECT SQL_NO_CACHE product_attribute_shop.`price`
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.`id_product_attribute` = 1830 LIMIT 1
0.151 ms 1 /classes/Combination.php:560
270
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1420 LIMIT 1
0.151 ms 1 /classes/SpecificPrice.php:435
691
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 3208 AND id_shop=1 LIMIT 1
0.151 ms 1 /classes/Product.php:6884
699
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 3207 LIMIT 1
0.151 ms 1 /classes/SpecificPrice.php:435
737
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (3986) AND il.`id_lang` = 2 ORDER by i.`position`
0.151 ms 1 Yes /classes/Product.php:2915
128
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1374
AND image_shop.`cover` = 1 LIMIT 1
0.150 ms 2 /classes/Product.php:3570
140
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1375
AND image_shop.`cover` = 1 LIMIT 1
0.150 ms 2 /classes/Product.php:3570
428
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 3314 LIMIT 1
0.150 ms 1 /classes/SpecificPrice.php:435
569
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3293
AND image_shop.`cover` = 1 LIMIT 1
0.150 ms 1 /classes/Product.php:3570
773
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (3930) AND il.`id_lang` = 2 ORDER by i.`position`
0.150 ms 1 Yes /classes/Product.php:2915
216
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1410 LIMIT 1
0.149 ms 1 /classes/SpecificPrice.php:435
725
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (3992) AND il.`id_lang` = 2 ORDER by i.`position`
0.149 ms 1 Yes /classes/Product.php:2915
758
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (3973) AND il.`id_lang` = 2 ORDER by i.`position`
0.149 ms 1 Yes /classes/Product.php:2915
155
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1377 LIMIT 1
0.148 ms 1 /classes/SpecificPrice.php:435
651
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 3211) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.148 ms 1 /classes/stock/StockAvailable.php:453
675
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 3209 LIMIT 1
0.148 ms 1 /classes/SpecificPrice.php:435
767
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (3936) AND il.`id_lang` = 2 ORDER by i.`position`
0.148 ms 1 Yes /classes/Product.php:2915
770
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (3934) AND il.`id_lang` = 2 ORDER by i.`position`
0.148 ms 1 Yes /classes/Product.php:2915
17
SELECT SQL_NO_CACHE * FROM `prstshp_hook_module_exceptions`
WHERE `id_shop` IN (1)
0.147 ms 1 /classes/module/Module.php:2046
233
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1414) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.147 ms 1 /classes/stock/StockAvailable.php:453
705
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 3207) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.147 ms 1 /classes/stock/StockAvailable.php:453
186
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1379) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.147 ms 1 /classes/stock/StockAvailable.php:453
687
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 3208 LIMIT 1
0.147 ms 1 /classes/SpecificPrice.php:435
749
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (3977) AND il.`id_lang` = 2 ORDER by i.`position`
0.146 ms 1 Yes /classes/Product.php:2915
312
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1424) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.146 ms 1 /classes/stock/StockAvailable.php:453
803
SELECT SQL_NO_CACHE SUM(`quantity`)
FROM `prstshp_cart_product`
WHERE `id_cart` = 0 LIMIT 1
0.146 ms 1 /classes/Cart.php:1300
34
SELECT SQL_NO_CACHE *
FROM `prstshp_group` a
LEFT JOIN `prstshp_group_shop` `c` ON a.`id_group` = c.`id_group` AND c.`id_shop` = 1
WHERE (a.`id_group` = 1) LIMIT 1
0.145 ms 1 /src/Adapter/EntityMapper.php:71
764
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (3937) AND il.`id_lang` = 2 ORDER by i.`position`
0.145 ms 1 Yes /classes/Product.php:2915
180
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1379 LIMIT 1
0.145 ms 1 /classes/SpecificPrice.php:435
376
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1435) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.145 ms 1 /classes/stock/StockAvailable.php:453
608
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 3264 LIMIT 1
0.145 ms 1 /classes/SpecificPrice.php:435
693
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 3208) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.145 ms 1 /classes/stock/StockAvailable.php:453
395
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1462 LIMIT 1
0.144 ms 1 /classes/SpecificPrice.php:435
731
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (3988) AND il.`id_lang` = 2 ORDER by i.`position`
0.144 ms 1 Yes /classes/Product.php:2915
746
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (3980) AND il.`id_lang` = 2 ORDER by i.`position`
0.143 ms 1 Yes /classes/Product.php:2915
760
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 3291
0.143 ms 1 /classes/Product.php:2899
92
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1365 AND id_shop=1 LIMIT 1
0.143 ms 1 /classes/Product.php:6884
243
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1416) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.142 ms 1 /classes/stock/StockAvailable.php:453
370
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1435 LIMIT 1
0.142 ms 1 /classes/SpecificPrice.php:435
382
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1436 LIMIT 1
0.142 ms 1 /classes/SpecificPrice.php:435
42
SELECT SQL_NO_CACHE state FROM prstshp_feature_flag WHERE name = 'multiple_image_format' LIMIT 1
0.142 ms 1 /classes/FeatureFlag.php:105
69
SELECT SQL_NO_CACHE *
FROM `prstshp_state` a
WHERE (a.`id_state` = 362) LIMIT 1
0.142 ms 1 /src/Adapter/EntityMapper.php:71
210
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1398) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.142 ms 1 /classes/stock/StockAvailable.php:453
329
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1426) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.142 ms 1 /classes/stock/StockAvailable.php:453
364
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1430) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.142 ms 1 /classes/stock/StockAvailable.php:453
468
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 3308 AND id_shop=1 LIMIT 1
0.142 ms 1 /classes/Product.php:6884
638
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 3258) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.142 ms 1 /classes/stock/StockAvailable.php:453
658
SELECT SQL_NO_CACHE *
FROM `prstshp_product_attribute` a
LEFT JOIN `prstshp_product_attribute_shop` `c` ON a.`id_product_attribute` = c.`id_product_attribute` AND c.`id_shop` = 1
WHERE (a.`id_product_attribute` = 3880) LIMIT 1
0.142 ms 1 /src/Adapter/EntityMapper.php:71
785
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (3876) AND il.`id_lang` = 2 ORDER by i.`position`
0.141 ms 1 Yes /classes/Product.php:2915
67
SELECT SQL_NO_CACHE *
FROM `prstshp_country` a
LEFT JOIN `prstshp_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 6) LIMIT 1
0.141 ms 1 /src/Adapter/EntityMapper.php:71
161
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1377) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.141 ms 1 /classes/stock/StockAvailable.php:453
324
SELECT SQL_NO_CACHE product_attribute_shop.`price`
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.`id_product_attribute` = 1832 LIMIT 1
0.141 ms 1 /classes/Combination.php:560
779
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (3878) AND il.`id_lang` = 2 ORDER by i.`position`
0.141 ms 1 Yes /classes/Product.php:2915
782
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (3877) AND il.`id_lang` = 2 ORDER by i.`position`
0.141 ms 1 Yes /classes/Product.php:2915
249
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1417 LIMIT 1
0.140 ms 1 /classes/SpecificPrice.php:435
399
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1462) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.140 ms 1 /classes/stock/StockAvailable.php:453
9
SELECT SQL_NO_CACHE id_shop
FROM `prstshp_lang_shop`
WHERE `id_lang` = 2
AND id_shop = 1 LIMIT 1
0.140 ms 1 /classes/ObjectModel.php:1727
116
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1373
AND image_shop.`cover` = 1 LIMIT 1
0.140 ms 2 /classes/Product.php:3570
192
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1382 LIMIT 1
0.140 ms 1 /classes/SpecificPrice.php:435
280
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1420) AND (id_product_attribute = 6946) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.140 ms 1 /classes/stock/StockAvailable.php:453
614
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 3264) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.140 ms 1 /classes/stock/StockAvailable.php:453
290
SELECT SQL_NO_CACHE product_attribute_shop.`price`
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.`id_product_attribute` = 1800 LIMIT 1
0.139 ms 1 /classes/Combination.php:560
427
SELECT SQL_NO_CACHE `name`
FROM `prstshp_manufacturer`
WHERE `id_manufacturer` = 17
AND `active` = 1 LIMIT 1
0.139 ms 0 /classes/Manufacturer.php:312
743
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (3982) AND il.`id_lang` = 2 ORDER by i.`position`
0.139 ms 1 Yes /classes/Product.php:2915
198
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1382) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.138 ms 1 /classes/stock/StockAvailable.php:453
325
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1426 LIMIT 1
0.138 ms 1 /classes/SpecificPrice.php:435
488
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 3306 LIMIT 1
0.138 ms 1 /classes/SpecificPrice.php:435
788
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (3875) AND il.`id_lang` = 2 ORDER by i.`position`
0.138 ms 1 Yes /classes/Product.php:2915
401
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1462) AND (id_product_attribute = 1841) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.138 ms 1 /classes/stock/StockAvailable.php:453
62
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module` WHERE `name` = "ps_legalcompliance" LIMIT 1
0.137 ms 0 /classes/module/Module.php:2664
362
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1430 AND id_shop=1 LIMIT 1
0.137 ms 1 /classes/Product.php:6884
456
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 3310 AND id_shop=1 LIMIT 1
0.137 ms 1 /classes/Product.php:6884
500
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 3305 LIMIT 1
0.137 ms 1 /classes/SpecificPrice.php:435
222
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1410) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.136 ms 1 /classes/stock/StockAvailable.php:453
259
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1418 LIMIT 1
0.136 ms 1 /classes/SpecificPrice.php:435
584
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 3291 LIMIT 1
0.136 ms 1 /classes/SpecificPrice.php:435
239
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1416 LIMIT 1
0.136 ms 1 /classes/SpecificPrice.php:435
295
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1421) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.136 ms 1 /classes/stock/StockAvailable.php:453
346
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1428) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.136 ms 1 /classes/stock/StockAvailable.php:453
548
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 3296 LIMIT 1
0.136 ms 1 /classes/SpecificPrice.php:435
30
SELECT SQL_NO_CACHE `id_lang` FROM `prstshp_lang`
WHERE `locale` = 'es-es'
OR `language_code` = 'es-es' LIMIT 1
0.135 ms 2 /classes/Language.php:880
251
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1417 AND id_shop=1 LIMIT 1
0.135 ms 1 /classes/Product.php:6884
572
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 3293 LIMIT 1
0.135 ms 1 /classes/SpecificPrice.php:435
303
SELECT SQL_NO_CACHE *
FROM `prstshp_product_attribute_lang`
WHERE `id_product_attribute` = 1800
0.135 ms 2 /src/Adapter/EntityMapper.php:79
560
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 3295 LIMIT 1
0.135 ms 1 /classes/SpecificPrice.php:435
681
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 3209) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.135 ms 1 /classes/stock/StockAvailable.php:453
24
SELECT SQL_NO_CACHE c.id_currency
FROM `prstshp_currency` c
WHERE (iso_code = 'EUR') LIMIT 1
0.134 ms 1 /classes/Currency.php:893
331
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1426) AND (id_product_attribute = 1832) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.134 ms 1 /classes/stock/StockAvailable.php:453
506
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 3305) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.134 ms 1 /classes/stock/StockAvailable.php:453
288
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 15 LIMIT 1
0.133 ms 1 /classes/Product.php:5670
512
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 3302 LIMIT 1
0.133 ms 1 /classes/SpecificPrice.php:435
106
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `prstshp_category_lang` cl
WHERE `id_lang` = 2
AND cl.id_shop = 1 
AND cl.`id_category` = 17 LIMIT 1
0.132 ms 1 /classes/Category.php:1373
253
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1417) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.132 ms 1 /classes/stock/StockAvailable.php:453
320
SELECT SQL_NO_CACHE *
FROM `prstshp_product_attribute_lang`
WHERE `id_product_attribute` = 1830
0.132 ms 2 /src/Adapter/EntityMapper.php:79
438
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.132 ms 1 /classes/Product.php:5670
482
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 3307) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.132 ms 1 /classes/stock/StockAvailable.php:453
524
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 3300 LIMIT 1
0.132 ms 1 /classes/SpecificPrice.php:435
536
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 3297 LIMIT 1
0.132 ms 1 /classes/SpecificPrice.php:435
204
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1398 LIMIT 1
0.132 ms 1 /classes/SpecificPrice.php:435
229
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1414 LIMIT 1
0.132 ms 1 /classes/SpecificPrice.php:435
530
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 3300) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.132 ms 1 /classes/stock/StockAvailable.php:453
470
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 3308) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.131 ms 1 /classes/stock/StockAvailable.php:453
630
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.131 ms 1 /classes/Product.php:5670
8
SELECT SQL_NO_CACHE *
FROM `prstshp_lang` a
LEFT JOIN `prstshp_lang_shop` `c` ON a.`id_lang` = c.`id_lang` AND c.`id_shop` = 1
WHERE (a.`id_lang` = 2) LIMIT 1
0.131 ms 1 /src/Adapter/EntityMapper.php:71
278
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1420) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.131 ms 1 /classes/stock/StockAvailable.php:453
590
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 3291) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.131 ms 1 /classes/stock/StockAvailable.php:453
341
SELECT SQL_NO_CACHE product_attribute_shop.`price`
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.`id_product_attribute` = 1834 LIMIT 1
0.130 ms 1 /classes/Combination.php:560
407
SELECT SQL_NO_CACHE *
FROM `prstshp_product_attribute_lang`
WHERE `id_product_attribute` = 1841
0.130 ms 2 /src/Adapter/EntityMapper.php:79
23
SELECT SQL_NO_CACHE value FROM `prstshp_configuration` WHERE `name` = "PS_MULTISHOP_FEATURE_ACTIVE" LIMIT 1
0.129 ms 1 /classes/shop/Shop.php:1183
286
SELECT SQL_NO_CACHE *
FROM `prstshp_product_attribute_lang`
WHERE `id_product_attribute` = 6946
0.129 ms 2 /src/Adapter/EntityMapper.php:79
542
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 3297) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.129 ms 1 /classes/stock/StockAvailable.php:453
645
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 3211 LIMIT 1
0.129 ms 1 /classes/SpecificPrice.php:435
74
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module` WHERE `name` = "ps_accounts" LIMIT 1
0.128 ms 1 /src/Adapter/Module/ModuleDataProvider.php:256
214
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.128 ms 1 /classes/Product.php:5670
297
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1421) AND (id_product_attribute = 1800) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.128 ms 1 /classes/stock/StockAvailable.php:453
308
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1424 LIMIT 1
0.128 ms 1 /classes/SpecificPrice.php:435
510
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.128 ms 1 /classes/Product.php:5670
554
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 3296) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.127 ms 1 /classes/stock/StockAvailable.php:453
688
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 3208
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.127 ms 0 /classes/SpecificPrice.php:256
327
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1426 AND id_shop=1 LIMIT 1
0.127 ms 1 /classes/Product.php:6884
380
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.126 ms 1 /classes/Product.php:5670
84
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 0 LIMIT 1
0.126 ms 1 /classes/SpecificPrice.php:426
314
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1424) AND (id_product_attribute = 1830) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.126 ms 1 /classes/stock/StockAvailable.php:453
7
SELECT SQL_NO_CACHE *
FROM `prstshp_shop_group` a
WHERE (a.`id_shop_group` = 1) LIMIT 1
0.125 ms 1 /src/Adapter/EntityMapper.php:71
498
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.125 ms 1 /classes/Product.php:5670
717
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 3206) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.125 ms 1 /classes/stock/StockAvailable.php:453
3
SELECT SQL_NO_CACHE *
FROM `prstshp_shop` a
WHERE (a.`id_shop` = 1) LIMIT 1
0.125 ms 1 /src/Adapter/EntityMapper.php:71
237
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 15 LIMIT 1
0.125 ms 1 /classes/Product.php:5670
348
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1428) AND (id_product_attribute = 1834) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.125 ms 1 /classes/stock/StockAvailable.php:453
386
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1436 AND id_shop=1 LIMIT 1
0.125 ms 1 /classes/Product.php:6884
453
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 3310
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.125 ms 0 /classes/SpecificPrice.php:256
825
SELECT SQL_NO_CACHE *
FROM `prstshp_product_lang`
WHERE `id_product` = 3211 AND `id_shop` = 1
0.125 ms 2 /src/Adapter/EntityMapper.php:79
840
SELECT SQL_NO_CACHE psgdprl.message FROM `prstshp_psgdpr_consent` psgdpr
LEFT JOIN prstshp_psgdpr_consent_lang psgdprl ON (psgdpr.id_gdpr_consent = psgdprl.id_gdpr_consent)
WHERE psgdpr.id_module = 22 AND psgdprl.id_lang =2 LIMIT 1
0.125 ms 8 /modules/psgdpr/classes/GDPRConsent.php:108
10
SELECT SQL_NO_CACHE domain, domain_ssl
FROM prstshp_shop_url
WHERE main = 1
AND id_shop = 1 LIMIT 1
0.124 ms 1 /classes/shop/ShopUrl.php:178
35
SELECT SQL_NO_CACHE *
FROM `prstshp_group_lang`
WHERE `id_group` = 1
0.124 ms 2 /src/Adapter/EntityMapper.php:79
339
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 15 LIMIT 1
0.124 ms 1 /classes/Product.php:5670
374
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1435 AND id_shop=1 LIMIT 1
0.124 ms 1 /classes/Product.php:6884
337
SELECT SQL_NO_CACHE *
FROM `prstshp_product_attribute_lang`
WHERE `id_product_attribute` = 1832
0.123 ms 2 /src/Adapter/EntityMapper.php:79
392
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 15 LIMIT 1
0.123 ms 1 /classes/Product.php:5670
653
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 3211) AND (id_product_attribute = 3880) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.123 ms 1 /classes/stock/StockAvailable.php:453
663
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 3210 LIMIT 1
0.122 ms 1 /classes/SpecificPrice.php:435
247
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 15 LIMIT 1
0.122 ms 1 /classes/Product.php:5670
272
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1420
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.122 ms 1 /classes/SpecificPrice.php:256
109
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1370 LIMIT 1
0.121 ms 1 /classes/SpecificPrice.php:435
566
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 3295) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.121 ms 1 /classes/stock/StockAvailable.php:453
826
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `prstshp_category_lang` cl
WHERE `id_lang` = 0
AND cl.id_shop = 1 
AND cl.`id_category` = 18 LIMIT 1
0.121 ms 0 /classes/Category.php:1373
397
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1462 AND id_shop=1 LIMIT 1
0.121 ms 1 /classes/Product.php:6884
184
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1379 AND id_shop=1 LIMIT 1
0.120 ms 1 /classes/Product.php:6884
659
SELECT SQL_NO_CACHE *
FROM `prstshp_product_attribute_lang`
WHERE `id_product_attribute` = 3880
0.120 ms 2 /src/Adapter/EntityMapper.php:79
167
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1378 LIMIT 1
0.120 ms 1 /classes/SpecificPrice.php:435
715
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 3206 AND id_shop=1 LIMIT 1
0.120 ms 1 /classes/Product.php:6884
754
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 3295
0.120 ms 1 /classes/Product.php:2899
703
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 3207 AND id_shop=1 LIMIT 1
0.119 ms 1 /classes/Product.php:6884
241
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1416 AND id_shop=1 LIMIT 1
0.119 ms 1 /classes/Product.php:6884
618
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.119 ms 1 /classes/Product.php:5670
685
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.119 ms 1 /classes/Product.php:5670
697
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.119 ms 1 /classes/Product.php:5670
22
SELECT SQL_NO_CACHE `id_lang` FROM `prstshp_lang`
WHERE `locale` = 'es-es'
OR `language_code` = 'es-es' LIMIT 1
0.118 ms 2 /classes/Language.php:880
32
SELECT SQL_NO_CACHE *
FROM `prstshp_currency_lang`
WHERE `id_currency` = 2
0.118 ms 2 /src/Adapter/EntityMapper.php:79
97
SELECT SQL_NO_CACHE *
FROM `prstshp_tax_lang`
WHERE `id_tax` = 53
0.118 ms 2 /src/Adapter/EntityMapper.php:79
226
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `prstshp_category_lang` cl
WHERE `id_lang` = 2
AND cl.id_shop = 1 
AND cl.`id_category` = 15 LIMIT 1
0.118 ms 1 /classes/Category.php:1373
257
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 15 LIMIT 1
0.118 ms 1 /classes/Product.php:5670
354
SELECT SQL_NO_CACHE *
FROM `prstshp_product_attribute_lang`
WHERE `id_product_attribute` = 1834
0.118 ms 2 /src/Adapter/EntityMapper.php:79
368
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.118 ms 1 /classes/Product.php:5670
649
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 3211 AND id_shop=1 LIMIT 1
0.118 ms 1 /classes/Product.php:6884
673
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.118 ms 1 /classes/Product.php:5670
37
SELECT SQL_NO_CACHE `id_category`
FROM `prstshp_category_shop`
WHERE `id_category` = 2
AND `id_shop` = 1 LIMIT 1
0.117 ms 1 /classes/Category.php:2446
267
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.117 ms 1 /classes/Product.php:5670
291
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1421 LIMIT 1
0.117 ms 1 /classes/SpecificPrice.php:435
480
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 3307 AND id_shop=1 LIMIT 1
0.117 ms 1 /classes/Product.php:6884
633
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 3258
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.117 ms 0 /classes/SpecificPrice.php:256
642
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.117 ms 1 /classes/Product.php:5670
709
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.117 ms 1 /classes/Product.php:5670
721
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 3314
0.117 ms 1 /classes/Product.php:2899
493
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 3306 AND `id_group` = 1 LIMIT 1
0.117 ms 0 /classes/GroupReduction.php:153
26
SELECT SQL_NO_CACHE `id_lang` FROM `prstshp_lang`
WHERE `locale` = 'es-es'
OR `language_code` = 'es-es' LIMIT 1
0.116 ms 2 /classes/Language.php:880
220
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1410 AND id_shop=1 LIMIT 1
0.116 ms 1 /classes/Product.php:6884
534
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.116 ms 1 /classes/Product.php:5670
636
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 3258 AND id_shop=1 LIMIT 1
0.116 ms 1 /classes/Product.php:6884
196
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1382 AND id_shop=1 LIMIT 1
0.116 ms 1 /classes/Product.php:6884
208
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1398 AND id_shop=1 LIMIT 1
0.116 ms 1 /classes/Product.php:6884
464
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 3308 LIMIT 1
0.116 ms 1 /classes/SpecificPrice.php:435
27
SELECT SQL_NO_CACHE `id_lang` FROM `prstshp_lang`
WHERE `locale` = 'es-es'
OR `language_code` = 'es-es' LIMIT 1
0.115 ms 2 /classes/Language.php:880
168
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1378
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.115 ms 1 /classes/SpecificPrice.php:256
202
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.115 ms 1 /classes/Product.php:5670
342
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1428 LIMIT 1
0.115 ms 1 /classes/SpecificPrice.php:435
119
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1373 LIMIT 1
0.115 ms 1 /classes/SpecificPrice.php:435
602
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 3265) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.115 ms 1 /classes/stock/StockAvailable.php:453
322
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 15 LIMIT 1
0.114 ms 1 /classes/Product.php:5670
383
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1436
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.114 ms 0 /classes/SpecificPrice.php:256
839
SELECT SQL_NO_CACHE psgdpr.active FROM `prstshp_psgdpr_consent` psgdpr
WHERE psgdpr.id_module = 22 LIMIT 1
0.114 ms 8 /modules/psgdpr/classes/GDPRConsent.php:130
68
SELECT SQL_NO_CACHE *
FROM `prstshp_country_lang`
WHERE `id_country` = 6
0.113 ms 2 /src/Adapter/EntityMapper.php:79
72
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module` WHERE `name` = "ps_facebook" LIMIT 1
0.113 ms 1 /classes/module/Module.php:2664
356
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 14 LIMIT 1
0.113 ms 1 /classes/Product.php:5670
371
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1435
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.113 ms 0 /classes/SpecificPrice.php:256
612
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 3264 AND id_shop=1 LIMIT 1
0.113 ms 1 /classes/Product.php:6884
799
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module` WHERE `name` = "ps_languageselector" LIMIT 1
0.113 ms 1 /classes/module/Module.php:2664
66
SELECT SQL_NO_CACHE `need_identification_number`
FROM `prstshp_country`
WHERE `id_country` = 6 LIMIT 1
0.112 ms 1 /classes/Country.php:402
86
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE `id_product` != 0 LIMIT 1
0.112 ms 1808 /classes/SpecificPrice.php:297
516
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 3302 AND id_shop=1 LIMIT 1
0.112 ms 1 /classes/Product.php:6884
669
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 3210) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.112 ms 1 /classes/stock/StockAvailable.php:453
700
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 3207
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.112 ms 0 /classes/SpecificPrice.php:256
841
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module` WHERE `name` = "iqitcookielaw" LIMIT 1
0.112 ms 1 /classes/module/Module.php:2664
528
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 3300 AND id_shop=1 LIMIT 1
0.112 ms 1 /classes/Product.php:6884
193
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1382
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.111 ms 0 /classes/SpecificPrice.php:256
293
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1421 AND id_shop=1 LIMIT 1
0.111 ms 1 /classes/Product.php:6884
359
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1430
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.111 ms 0 /classes/SpecificPrice.php:256
261
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1418 AND id_shop=1 LIMIT 1
0.111 ms 1 /classes/Product.php:6884
474
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.111 ms 1 /classes/Product.php:5670
28
SELECT SQL_NO_CACHE c.id_currency
FROM `prstshp_currency` c
WHERE (iso_code = 'USD') LIMIT 1
0.110 ms 1 /classes/Currency.php:893
96
SELECT SQL_NO_CACHE *
FROM `prstshp_tax` a
WHERE (a.`id_tax` = 53) LIMIT 1
0.110 ms 1 /src/Adapter/EntityMapper.php:71
486
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.110 ms 1 /classes/Product.php:5670
522
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.110 ms 1 /classes/Product.php:5670
646
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 3211
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.110 ms 0 /classes/SpecificPrice.php:256
33
SELECT SQL_NO_CACHE id_shop
FROM `prstshp_currency_shop`
WHERE `id_currency` = 2
AND id_shop = 1 LIMIT 1
0.109 ms 1 /classes/ObjectModel.php:1727
462
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.109 ms 1 /classes/Product.php:5670
573
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 3293
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.109 ms 0 /classes/SpecificPrice.php:256
77
SELECT SQL_NO_CACHE *
FROM `prstshp_configuration` a
WHERE (a.`id_configuration` = 1315) LIMIT 1
0.109 ms 1 /src/Adapter/EntityMapper.php:71
231
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1414 AND id_shop=1 LIMIT 1
0.109 ms 1 /classes/Product.php:6884
305
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 15 LIMIT 1
0.109 ms 1 /classes/Product.php:5670
525
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 3300
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.109 ms 0 /classes/SpecificPrice.php:256
588
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 3291 AND id_shop=1 LIMIT 1
0.109 ms 1 /classes/Product.php:6884
724
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 3312
0.109 ms 1 /classes/Product.php:2899
205
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1398
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.108 ms 0 /classes/SpecificPrice.php:256
227
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 15 LIMIT 1
0.108 ms 1 /classes/Product.php:5670
481
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 3307 AND `id_group` = 1 LIMIT 1
0.108 ms 0 /classes/GroupReduction.php:153
492
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 3306 AND id_shop=1 LIMIT 1
0.108 ms 1 /classes/Product.php:6884
540
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 3297 AND id_shop=1 LIMIT 1
0.108 ms 1 /classes/Product.php:6884
564
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 3295 AND id_shop=1 LIMIT 1
0.108 ms 1 /classes/Product.php:6884
712
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 3206
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.108 ms 0 /classes/SpecificPrice.php:256
792
SELECT SQL_NO_CACHE c.id_elementor FROM prstshp_iqit_elementor_category c WHERE c.id_category = 2 LIMIT 1
0.108 ms 1 /modules/iqitelementor/src/IqitElementorCategory.php:87
98
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1365 AND `id_group` = 1 LIMIT 1
0.107 ms 0 /classes/GroupReduction.php:153
477
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 3307
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.107 ms 0 /classes/SpecificPrice.php:256
597
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 3265
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.107 ms 0 /classes/SpecificPrice.php:256
606
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.107 ms 1 /classes/Product.php:5670
609
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 3264
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.107 ms 0 /classes/SpecificPrice.php:256
727
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 3310
0.107 ms 1 /classes/Product.php:2899
745
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 3300
0.107 ms 1 /classes/Product.php:2899
310
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1424 AND id_shop=1 LIMIT 1
0.106 ms 1 /classes/Product.php:6884
375
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1435 AND `id_group` = 1 LIMIT 1
0.106 ms 0 /classes/GroupReduction.php:153
457
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 3310 AND `id_group` = 1 LIMIT 1
0.106 ms 0 /classes/GroupReduction.php:153
679
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 3209 AND id_shop=1 LIMIT 1
0.106 ms 1 /classes/Product.php:6884
582
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.106 ms 1 /classes/Product.php:5670
775
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 3211
0.106 ms 2 /classes/Product.php:2899
328
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1426 AND `id_group` = 1 LIMIT 1
0.105 ms 0 /classes/GroupReduction.php:153
387
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1436 AND `id_group` = 1 LIMIT 1
0.105 ms 0 /classes/GroupReduction.php:153
398
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1462 AND `id_group` = 1 LIMIT 1
0.105 ms 0 /classes/GroupReduction.php:153
600
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 3265 AND id_shop=1 LIMIT 1
0.105 ms 1 /classes/Product.php:6884
676
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 3209
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.105 ms 0 /classes/SpecificPrice.php:256
796
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module` WHERE `name` = "iqitlinksmanager" LIMIT 1
0.105 ms 1 /classes/module/Module.php:2664
469
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 3308 AND `id_group` = 1 LIMIT 1
0.105 ms 0 /classes/GroupReduction.php:153
561
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 3295
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.105 ms 0 /classes/SpecificPrice.php:256
626
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 3262) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.105 ms 1 /classes/stock/StockAvailable.php:453
38
SELECT SQL_NO_CACHE ctg.`id_group`
FROM prstshp_category_group ctg
WHERE ctg.`id_category` = 2 AND ctg.`id_group` = 1 LIMIT 1
0.104 ms 1 /classes/Category.php:1751
513
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 3302
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.104 ms 0 /classes/SpecificPrice.php:256
65
SELECT SQL_NO_CACHE format
FROM `prstshp_address_format`
WHERE `id_country` = 6 LIMIT 1
0.104 ms 1 /classes/AddressFormat.php:653
81
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `prstshp_category_lang` cl
WHERE `id_lang` = 2
AND cl.id_shop = 1 
AND cl.`id_category` = 18 LIMIT 1
0.104 ms 1 /classes/Category.php:1373
125
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1373) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.104 ms 1 /classes/stock/StockAvailable.php:453
546
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.104 ms 1 /classes/Product.php:5670
552
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 3296 AND id_shop=1 LIMIT 1
0.104 ms 1 /classes/Product.php:6884
558
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.104 ms 1 /classes/Product.php:5670
730
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 3308
0.104 ms 1 /classes/Product.php:2899
73
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module_shop` WHERE `id_module` = 61 AND `id_shop` = 1 LIMIT 1
0.103 ms 1 /classes/module/Module.php:2137
131
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1374 LIMIT 1
0.103 ms 1 /classes/SpecificPrice.php:435
181
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1379
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.103 ms 0 /classes/SpecificPrice.php:256
549
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 3296
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.103 ms 0 /classes/SpecificPrice.php:256
578
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 3293) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.103 ms 1 /classes/stock/StockAvailable.php:453
275
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1420 AND id_shop=1 LIMIT 1
0.102 ms 1 /classes/Product.php:6884
344
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1428 AND id_shop=1 LIMIT 1
0.102 ms 1 /classes/Product.php:6884
501
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 3305
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.102 ms 0 /classes/SpecificPrice.php:256
504
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 3305 AND id_shop=1 LIMIT 1
0.102 ms 1 /classes/Product.php:6884
769
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 3262
0.102 ms 1 /classes/Product.php:2899
781
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 3209
0.102 ms 1 /classes/Product.php:2899
529
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 3300 AND `id_group` = 1 LIMIT 1
0.101 ms 0 /classes/GroupReduction.php:153
637
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 3258 AND `id_group` = 1 LIMIT 1
0.101 ms 0 /classes/GroupReduction.php:153
837
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module` WHERE `name` = "ps_emailsubscription" LIMIT 1
0.101 ms 1 /classes/module/Module.php:2664
137
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1374) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.101 ms 1 /classes/stock/StockAvailable.php:453
363
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1430 AND `id_group` = 1 LIMIT 1
0.101 ms 0 /classes/GroupReduction.php:153
621
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 3262
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.101 ms 0 /classes/SpecificPrice.php:256
36
SELECT SQL_NO_CACHE id_shop
FROM `prstshp_group_shop`
WHERE `id_group` = 1
AND id_shop = 1 LIMIT 1
0.100 ms 1 /classes/ObjectModel.php:1727
692
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 3208 AND `id_group` = 1 LIMIT 1
0.100 ms 0 /classes/GroupReduction.php:153
217
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1410
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.100 ms 0 /classes/SpecificPrice.php:256
221
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1410 AND `id_group` = 1 LIMIT 1
0.100 ms 0 /classes/GroupReduction.php:153
736
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 3306
0.100 ms 1 /classes/Product.php:2899
733
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 3307
0.099 ms 1 /classes/Product.php:2899
153
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.099 ms 1 /classes/Product.php:5670
209
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1398 AND `id_group` = 1 LIMIT 1
0.099 ms 0 /classes/GroupReduction.php:153
429
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 3314
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.099 ms 0 /classes/SpecificPrice.php:256
585
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 3291
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.099 ms 0 /classes/SpecificPrice.php:256
661
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.099 ms 1 /classes/Product.php:5670
680
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 3209 AND `id_group` = 1 LIMIT 1
0.099 ms 0 /classes/GroupReduction.php:153
739
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 3305
0.099 ms 1 /classes/Product.php:2899
757
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 3293
0.099 ms 1 /classes/Product.php:2899
766
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 3264
0.099 ms 1 /classes/Product.php:2899
778
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 3210
0.099 ms 1 /classes/Product.php:2899
804
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module` WHERE `name` = "iqitmegamenu" LIMIT 1
0.099 ms 1 /classes/module/Module.php:2664
149
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1375) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.098 ms 1 /classes/stock/StockAvailable.php:453
232
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1414 AND `id_group` = 1 LIMIT 1
0.098 ms 0 /classes/GroupReduction.php:153
242
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1416 AND `id_group` = 1 LIMIT 1
0.098 ms 0 /classes/GroupReduction.php:153
444
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 3312 AND id_shop=1 LIMIT 1
0.098 ms 1 /classes/Product.php:6884
624
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 3262 AND id_shop=1 LIMIT 1
0.098 ms 1 /classes/Product.php:6884
751
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 3296
0.098 ms 1 /classes/Product.php:2899
197
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1382 AND `id_group` = 1 LIMIT 1
0.097 ms 0 /classes/GroupReduction.php:153
704
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 3207 AND `id_group` = 1 LIMIT 1
0.097 ms 0 /classes/GroupReduction.php:153
576
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 3293 AND id_shop=1 LIMIT 1
0.097 ms 1 /classes/Product.php:6884
748
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 3297
0.097 ms 1 /classes/Product.php:2899
589
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 3291 AND `id_group` = 1 LIMIT 1
0.096 ms 0 /classes/GroupReduction.php:153
772
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 3258
0.096 ms 1 /classes/Product.php:2899
763
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 3265
0.096 ms 1 /classes/Product.php:2899
70
SELECT SQL_NO_CACHE id_required_field, object_name, field_name
FROM prstshp_required_field
0.095 ms 1 /classes/ObjectModel.php:1592
252
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1417 AND `id_group` = 1 LIMIT 1
0.095 ms 0 /classes/GroupReduction.php:153
425
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.095 ms 1 /classes/Product.php:5670
613
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 3264 AND `id_group` = 1 LIMIT 1
0.095 ms 0 /classes/GroupReduction.php:153
784
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 3208
0.095 ms 1 /classes/Product.php:2899
159
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1377 AND id_shop=1 LIMIT 1
0.094 ms 1 /classes/Product.php:6884
505
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 3305 AND `id_group` = 1 LIMIT 1
0.094 ms 0 /classes/GroupReduction.php:153
790
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 3206
0.094 ms 1 /classes/Product.php:2899
742
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 3302
0.094 ms 1 /classes/Product.php:2899
85
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1365 LIMIT 1
0.093 ms 1 /classes/SpecificPrice.php:435
107
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 17 LIMIT 1
0.093 ms 1 /classes/Product.php:5670
517
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 3302 AND `id_group` = 1 LIMIT 1
0.093 ms 0 /classes/GroupReduction.php:153
537
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 3297
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.093 ms 0 /classes/SpecificPrice.php:256
787
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 3207
0.093 ms 1 /classes/Product.php:2899
294
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1421 AND `id_group` = 1 LIMIT 1
0.092 ms 0 /classes/GroupReduction.php:153
489
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 3306
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.092 ms 0 /classes/SpecificPrice.php:256
441
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 3312
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.091 ms 0 /classes/SpecificPrice.php:256
565
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 3295 AND `id_group` = 1 LIMIT 1
0.091 ms 0 /classes/GroupReduction.php:153
625
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 3262 AND `id_group` = 1 LIMIT 1
0.091 ms 0 /classes/GroupReduction.php:153
99
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_group`
WHERE `id_group` = 1 LIMIT 1
0.091 ms 1 /classes/Group.php:151
132
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1374
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.090 ms 1 /classes/SpecificPrice.php:256
650
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 3211 AND `id_group` = 1 LIMIT 1
0.090 ms 0 /classes/GroupReduction.php:153
570
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.090 ms 1 /classes/Product.php:5670
111
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1370 AND id_shop=1 LIMIT 1
0.089 ms 1 /classes/Product.php:6884
465
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 3308
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.089 ms 0 /classes/SpecificPrice.php:256
594
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.089 ms 1 /classes/Product.php:5670
445
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 3312 AND `id_group` = 1 LIMIT 1
0.088 ms 0 /classes/GroupReduction.php:153
553
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 3296 AND `id_group` = 1 LIMIT 1
0.088 ms 0 /classes/GroupReduction.php:153
667
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 3210 AND id_shop=1 LIMIT 1
0.088 ms 1 /classes/Product.php:6884
797
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module_shop` WHERE `id_module` = 77 AND `id_shop` = 1 LIMIT 1
0.087 ms 1 /classes/module/Module.php:2137
87
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE `from` BETWEEN '2026-04-13 00:00:00' AND '2026-04-13 23:59:59' LIMIT 1
0.086 ms 1 /classes/SpecificPrice.php:377
311
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1424 AND `id_group` = 1 LIMIT 1
0.086 ms 0 /classes/GroupReduction.php:153
541
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 3297 AND `id_group` = 1 LIMIT 1
0.086 ms 0 /classes/GroupReduction.php:153
801
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module` WHERE `name` = "ps_currencyselector" LIMIT 1
0.086 ms 1 /classes/module/Module.php:2664
82
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.085 ms 1 /classes/Product.php:5670
141
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.085 ms 1 /classes/Product.php:5670
185
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1379 AND `id_group` = 1 LIMIT 1
0.085 ms 0 /classes/GroupReduction.php:153
838
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module_shop` WHERE `id_module` = 22 AND `id_shop` = 1 LIMIT 1
0.085 ms 1 /classes/module/Module.php:2137
345
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1428 AND `id_group` = 1 LIMIT 1
0.085 ms 0 /classes/GroupReduction.php:153
716
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 3206 AND `id_group` = 1 LIMIT 1
0.085 ms 0 /classes/GroupReduction.php:153
63
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.084 ms 0 /classes/module/Module.php:2137
664
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 3210
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.084 ms 0 /classes/SpecificPrice.php:256
842
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module_shop` WHERE `id_module` = 70 AND `id_shop` = 1 LIMIT 1
0.084 ms 1 /classes/module/Module.php:2137
276
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1420 AND `id_group` = 1 LIMIT 1
0.083 ms 0 /classes/GroupReduction.php:153
120
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1373
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.082 ms 1 /classes/SpecificPrice.php:256
135
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1374 AND id_shop=1 LIMIT 1
0.082 ms 1 /classes/Product.php:6884
160
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1377 AND `id_group` = 1 LIMIT 1
0.082 ms 0 /classes/GroupReduction.php:153
800
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module_shop` WHERE `id_module` = 27 AND `id_shop` = 1 LIMIT 1
0.082 ms 1 /classes/module/Module.php:2137
171
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1378 AND id_shop=1 LIMIT 1
0.081 ms 1 /classes/Product.php:6884
123
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1373 AND id_shop=1 LIMIT 1
0.080 ms 1 /classes/Product.php:6884
836
SELECT SQL_NO_CACHE domain,physical_uri FROM prstshp_shop_url
0.080 ms 1 /modules/corewhatsapp/corewhatsapp.php:179
129
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.080 ms 1 /classes/Product.php:5670
165
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.080 ms 1 /classes/Product.php:5670
117
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
0.079 ms 1 /classes/Product.php:5670
156
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1377
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.079 ms 1 /classes/SpecificPrice.php:256
147
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1375 AND id_shop=1 LIMIT 1
0.078 ms 1 /classes/Product.php:6884
805
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module_shop` WHERE `id_module` = 78 AND `id_shop` = 1 LIMIT 1
0.078 ms 1 /classes/module/Module.php:2137
433
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 3314 AND `id_group` = 1 LIMIT 1
0.077 ms 0 /classes/GroupReduction.php:153
802
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module_shop` WHERE `id_module` = 17 AND `id_shop` = 1 LIMIT 1
0.077 ms 1 /classes/module/Module.php:2137
144
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1375
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.076 ms 1 /classes/SpecificPrice.php:256
577
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 3293 AND `id_group` = 1 LIMIT 1
0.076 ms 0 /classes/GroupReduction.php:153
601
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 3265 AND `id_group` = 1 LIMIT 1
0.076 ms 0 /classes/GroupReduction.php:153
668
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 3210 AND `id_group` = 1 LIMIT 1
0.073 ms 0 /classes/GroupReduction.php:153
88
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE `to` BETWEEN '2026-04-13 00:00:00' AND '2026-04-13 23:59:59' LIMIT 1
0.070 ms 1 /classes/SpecificPrice.php:381
112
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1370 AND `id_group` = 1 LIMIT 1
0.069 ms 0 /classes/GroupReduction.php:153
172
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1378 AND `id_group` = 1 LIMIT 1
0.068 ms 0 /classes/GroupReduction.php:153
124
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1373 AND `id_group` = 1 LIMIT 1
0.063 ms 0 /classes/GroupReduction.php:153
136
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1374 AND `id_group` = 1 LIMIT 1
0.063 ms 0 /classes/GroupReduction.php:153
89
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1365
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.062 ms 0 /classes/SpecificPrice.php:256
148
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1375 AND `id_group` = 1 LIMIT 1
0.062 ms 0 /classes/GroupReduction.php:153

Doubles

55 queries
SELECT SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
55 queries
SELECT
            COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), XX) as deep_quantity,
            COALESCE(SUM(first_level_quantity), XX) as quantity
          FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, XX as pack_quantity
          FROM `prstshp_cart_product` cp
            WHERE cp.`id_product_attribute` = XX
            
            AND cp.`id_cart` = XX AND cp.`id_product` = XX UNION SELECT XX as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
          FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
            WHERE cp.`id_product_attribute` = XX
            
            AND cp.`id_cart` = XX AND p.`id_product_item` = XX AND (pr.`pack_stock_type` IN (XX,XX) OR (
            pr.`pack_stock_type` = XX
            AND XX = XX
        ))) as q LIMIT XX
49 queries
SELECT XX FROM `prstshp_specific_price` WHERE id_product = XX LIMIT XX
48 queries
SELECT image_shop.`id_image`
                    FROM `prstshp_image` i
                     INNER JOIN prstshp_image_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
                    WHERE i.`id_product` = XX
                    AND image_shop.`cover` = XX LIMIT XX
48 queries
SELECT name FROM prstshp_category_lang WHERE id_shop = XX AND id_lang = XX AND id_category = XX LIMIT XX
48 queries
SELECT *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = XX
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = XX
WHERE (a.`id_product` = XX) AND (b.`id_shop` = XX) LIMIT XX
48 queries
SELECT product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,XX) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = XX)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = XX)
WHERE (p.`id_product` = XX)
48 queries
                            SELECT `id_tax_rules_group`
                            FROM `prstshp_product_shop`
                            WHERE `id_product` = XX AND id_shop=XX LIMIT XX
48 queries
			SELECT `reduction`
			FROM `prstshp_product_group_reduction_cache`
			WHERE `id_product` = XX AND `id_group` = XX LIMIT XX
48 queries
                SELECT name, value, pf.id_feature, f.position, fvl.id_feature_value
                FROM prstshp_feature_product pf
                LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = XX)
                LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = XX)
                LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = XX)
                 INNER JOIN prstshp_feature_shop feature_shop
        ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = XX)
                WHERE pf.id_product = XX
                ORDER BY f.position ASC
39 queries
			SELECT *, ( IF (`id_group` = XX, XX, XX) +  IF (`id_country` = XX, XX, XX) +  IF (`id_currency` = XX, XX, XX) +  IF (`id_shop` = XX, XX, XX) +  IF (`id_customer` = XX, XX, XX)) AS `score`
				FROM `prstshp_specific_price`
				WHERE
                `id_shop` IN (XX, XX) AND
                `id_currency` IN (XX, XX) AND
                `id_country` IN (XX, XX) AND
                `id_group` IN (XX, XX) AND `id_product` = XX AND `id_customer` = XX AND `id_product_attribute` = XX AND `id_cart` = XX  AND (`from` = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' >= `from`) AND (`to` = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' <= `to`)
				AND IF(`from_quantity` > XX, `from_quantity`, XX) <= XX ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT XX
38 queries
				SELECT `priority`, `id_specific_price_priority`
				FROM `prstshp_specific_price_priority`
				WHERE `id_product` = XX
				ORDER BY `id_specific_price_priority` DESC LIMIT XX
24 queries
            SELECT image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
            FROM `prstshp_image` i
             INNER JOIN prstshp_image_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
            LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = XX)
            WHERE i.`id_product` = XX
            ORDER BY `position`
24 queries
SELECT `id_product_attribute`
            FROM `prstshp_product_attribute`
            WHERE `id_product` = XX
24 queries
SELECT pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > XX, XX, XX)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
            FROM `prstshp_product_attribute` pa
             INNER JOIN prstshp_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX) LEFT JOIN prstshp_stock_available stock
            ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, XX) AND stock.id_shop = XX  AND stock.id_shop_group = XX  )
            JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
            JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
            JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = XX)
            JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
            WHERE pa.`id_product` IN (XX) AND ag.`is_color_group` = XX
            GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
            HAVING qty > XX
            ORDER BY a.`position` ASC;
23 queries
            SELECT pai.`id_image`, pai.`id_product_attribute`, il.`legend`
            FROM `prstshp_product_attribute_image` pai
            LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
            LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
            WHERE pai.`id_product_attribute` IN (XX) AND il.`id_lang` = XX ORDER by i.`position`
20 queries
SELECT *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = XX
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = XX
WHERE (a.`id_category` = XX) AND (b.`id_shop` = XX) LIMIT XX
8 queries
SELECT `id_module` FROM `prstshp_module_shop` WHERE `id_module` = XX AND `id_shop` = XX LIMIT XX
7 queries
SELECT product_attribute_shop.`price`
			FROM `prstshp_product_attribute` pa
			 INNER JOIN prstshp_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX)
			WHERE pa.`id_product_attribute` = XX LIMIT XX
7 queries
SELECT pa.`available_date` FROM `prstshp_product` p LEFT JOIN `prstshp_product_attribute` pa ON (pa.`id_product` = p.`id_product`) INNER JOIN prstshp_product_shop product_shop
        ON (product_shop.id_product = p.id_product AND product_shop.id_shop = XX) INNER JOIN prstshp_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX) WHERE p.`id_product` = XX AND pa.`id_product` = XX AND pa.`id_product_attribute` = XX LIMIT XX
7 queries
            SELECT a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
            pa.`reference`, pa.`eanXX`, pa.`isbn`, pa.`upc`, pa.`mpn`,
            pal.`available_now`, pal.`available_later`
            FROM `prstshp_attribute` a
            LEFT JOIN `prstshp_attribute_lang` al
                ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = XX)
            LEFT JOIN `prstshp_product_attribute_combination` pac
                ON (pac.`id_attribute` = a.`id_attribute`)
            LEFT JOIN `prstshp_product_attribute` pa
                ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
             INNER JOIN prstshp_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX)
            LEFT JOIN `prstshp_product_attribute_lang` pal
                ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = XX)
            LEFT JOIN `prstshp_attribute_group_lang` agl
                ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = XX)
            WHERE pa.`id_product` = XX
                AND pac.`id_product_attribute` = XX
                AND agl.`id_lang` = XX
7 queries
SELECT *
FROM `prstshp_product_attribute` a
LEFT JOIN `prstshp_product_attribute_shop` `c` ON a.`id_product_attribute` = c.`id_product_attribute` AND c.`id_shop` = XX
WHERE (a.`id_product_attribute` = XX) LIMIT XX
7 queries
SELECT *
							FROM `prstshp_product_attribute_lang`
							WHERE `id_product_attribute` = XX
5 queries
			SELECT cl.`link_rewrite`
			FROM `prstshp_category_lang` cl
			WHERE `id_lang` = XX
			 AND cl.id_shop = XX 
			AND cl.`id_category` = XX LIMIT XX
4 queries
SELECT `id_lang` FROM `prstshp_lang`
                    WHERE `locale` = 'es-es'
                    OR `language_code` = 'es-es' LIMIT XX
3 queries
				SELECT tr.*
				FROM `prstshp_tax_rule` tr
				JOIN `prstshp_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
				WHERE trg.`active` = XX
				AND tr.`id_country` = XX
				AND tr.`id_tax_rules_group` = XX
				AND tr.`id_state` IN (XX, XX)
				AND ('XX' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
					OR (tr.`zipcode_to` = XX AND tr.`zipcode_from` IN(XX, 'XX')))
				ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
2 queries
SELECT value FROM `prstshp_configuration` WHERE `name` = "PS_MULTISHOP_FEATURE_ACTIVE" LIMIT XX
2 queries
SELECT *
FROM `prstshp_currency` a
LEFT JOIN `prstshp_currency_lang` `b` ON a.`id_currency` = b.`id_currency` AND b.`id_lang` = XX
LEFT JOIN `prstshp_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = XX
WHERE (a.`id_currency` = XX) LIMIT XX
2 queries
		SELECT `id_category`
		FROM `prstshp_category_shop`
		WHERE `id_category` = XX
		AND `id_shop` = XX LIMIT XX
2 queries
SELECT *
FROM `prstshp_category` aXX
LEFT JOIN `prstshp_category_lang` `aXX` ON (aXX.`id_category` = aXX.`id_category`)
WHERE (aXX.`nleft` < XX) AND (aXX.`nright` > XX) AND (aXX.`id_lang` = XX) AND (aXX.`id_shop` = XX)
ORDER BY aXX.`nleft` asc
2 queries
SELECT XX FROM `prstshp_cart_rule` WHERE ((date_to >= "XX-XX-XX XX:XX:XX" AND date_to <= "XX-XX-XX XX:XX:XX") OR (date_from >= "XX-XX-XX XX:XX:XX" AND date_from <= "XX-XX-XX XX:XX:XX") OR (date_from < "XX-XX-XX XX:XX:XX" AND date_to > "XX-XX-XX XX:XX:XX")) AND `id_customer` IN (XX,XX) LIMIT XX

Tables stress

165 product
158 product_shop
112 cart_product
102 product_attribute_shop
96 image
92 specific_price
83 category_lang
83 stock_available
79 product_attribute
73 image_shop
55 pack
51 product_lang
49 image_lang
48 product_group_reduction_cache
48 feature_product
48 feature_lang
48 feature_value_lang
48 feature
48 feature_shop
38 specific_price_priority
34 product_attribute_combination
33 category
32 attribute
32 attribute_lang
25 attribute_group
24 category_shop
24 product_attribute_image
14 product_attribute_lang
13 module
10 module_shop
8 attribute_group_lang
7 lang
7 hook
7 currency
6 category_group
5 shop_url
5 configuration
5 currency_shop
5 category_product
4 shop
4 lang_shop
3 country
3 hook_alias
3 currency_lang
3 image_type
3 tax_rule
3 tax_rules_group
2 shop_group
2 configuration_lang
2 country_lang
2 country_shop
2 hook_module
2 group
2 group_shop
2 manufacturer
2 product_sale
2 cart_rule
2 psgdpr_consent
1 module_group
1 meta
1 meta_lang
1 hook_module_exceptions
1 group_lang
1 feature_flag
1 address_format
1 state
1 required_field
1 tax
1 tax_lang
1 layered_category
1 layered_filter_block
1 layered_price_index
1 iqit_elementor_category
1 corewhatsapp
1 psgdpr_consent_lang
1 connections

ObjectModel instances

Name Instances Source
Product 97 /classes/Link.php:113 (__construct) [id: 1365]
/classes/Link.php:113 (__construct) [id: 1370]
/classes/Link.php:113 (__construct) [id: 1373]
/classes/Link.php:113 (__construct) [id: 1374]
/classes/Link.php:113 (__construct) [id: 1375]
/classes/Link.php:113 (__construct) [id: 1377]
/classes/Link.php:113 (__construct) [id: 1378]
/classes/Link.php:113 (__construct) [id: 1379]
/classes/Link.php:113 (__construct) [id: 1382]
/classes/Link.php:113 (__construct) [id: 1398]
/classes/Link.php:113 (__construct) [id: 1410]
/classes/Link.php:113 (__construct) [id: 1414]
/classes/Link.php:113 (__construct) [id: 1416]
/classes/Link.php:113 (__construct) [id: 1417]
/classes/Link.php:113 (__construct) [id: 1418]
/classes/Link.php:113 (__construct) [id: 1420]
/classes/Link.php:113 (__construct) [id: 1421]
/classes/Link.php:113 (__construct) [id: 1424]
/classes/Link.php:113 (__construct) [id: 1426]
/classes/Link.php:113 (__construct) [id: 1428]
/classes/Link.php:113 (__construct) [id: 1430]
/classes/Link.php:113 (__construct) [id: 1435]
/classes/Link.php:113 (__construct) [id: 1436]
/classes/Link.php:113 (__construct) [id: 1462]
/classes/Link.php:113 (__construct) [id: 3314]
/classes/Link.php:113 (__construct) [id: 3312]
/classes/Link.php:113 (__construct) [id: 3310]
/classes/Link.php:113 (__construct) [id: 3308]
/classes/Link.php:113 (__construct) [id: 3307]
/classes/Link.php:113 (__construct) [id: 3306]
/classes/Link.php:113 (__construct) [id: 3305]
/classes/Link.php:113 (__construct) [id: 3302]
/classes/Link.php:113 (__construct) [id: 3300]
/classes/Link.php:113 (__construct) [id: 3297]
/classes/Link.php:113 (__construct) [id: 3296]
/classes/Link.php:113 (__construct) [id: 3295]
/classes/Link.php:113 (__construct) [id: 3293]
/classes/Link.php:113 (__construct) [id: 3291]
/classes/Link.php:113 (__construct) [id: 3265]
/classes/Link.php:113 (__construct) [id: 3264]
/classes/Link.php:113 (__construct) [id: 3262]
/classes/Link.php:113 (__construct) [id: 3258]
/classes/Link.php:113 (__construct) [id: 3211]
/classes/Link.php:113 (__construct) [id: 3210]
/classes/Link.php:113 (__construct) [id: 3209]
/classes/Link.php:113 (__construct) [id: 3208]
/classes/Link.php:113 (__construct) [id: 3207]
/classes/Link.php:113 (__construct) [id: 3206]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 3314]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 3312]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 3310]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 3308]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 3307]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 3306]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 3305]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 3302]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 3300]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 3297]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 3296]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 3295]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 3293]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 3291]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 3265]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 3264]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 3262]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 3258]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 3211]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 3210]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 3209]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 3208]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 3207]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 3206]
/classes/Link.php:113 (__construct) [id: 3314]
/classes/Link.php:113 (__construct) [id: 3312]
/classes/Link.php:113 (__construct) [id: 3310]
/classes/Link.php:113 (__construct) [id: 3308]
/classes/Link.php:113 (__construct) [id: 3307]
/classes/Link.php:113 (__construct) [id: 3306]
/classes/Link.php:113 (__construct) [id: 3305]
/classes/Link.php:113 (__construct) [id: 3302]
/classes/Link.php:113 (__construct) [id: 3300]
/classes/Link.php:113 (__construct) [id: 3297]
/classes/Link.php:113 (__construct) [id: 3296]
/classes/Link.php:113 (__construct) [id: 3295]
/classes/Link.php:113 (__construct) [id: 3293]
/classes/Link.php:113 (__construct) [id: 3291]
/classes/Link.php:113 (__construct) [id: 3265]
/classes/Link.php:113 (__construct) [id: 3264]
/classes/Link.php:113 (__construct) [id: 3262]
/classes/Link.php:113 (__construct) [id: 3258]
/classes/Link.php:113 (__construct) [id: 3211]
/classes/Link.php:113 (__construct) [id: 3210]
/classes/Link.php:113 (__construct) [id: 3209]
/classes/Link.php:113 (__construct) [id: 3208]
/classes/Link.php:113 (__construct) [id: 3207]
/classes/Link.php:113 (__construct) [id: 3206]
/src/Adapter/Presenter/Product/ProductLazyArray.php:658 (__construct) [id: 3211]
Category 25 /controllers/front/listing/CategoryController.php:76 (__construct) [id: 2]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 96]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 14]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 15]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 16]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 17]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 18]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 70]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 59]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 68]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 79]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 86]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 87]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 93]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 112]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 122]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 113]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 115]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 117]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 124]
/classes/Meta.php:379 (__construct) [id: 2]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/classes/Link.php:402 (__construct) [id: 2]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/modules/ps_facetedsearch/src/Filters/Block.php:157 (__construct) [id: 2]
Combination 7 /classes/Product.php:5923 (__construct) [id: 6946]
/classes/Product.php:5923 (__construct) [id: 1800]
/classes/Product.php:5923 (__construct) [id: 1830]
/classes/Product.php:5923 (__construct) [id: 1832]
/classes/Product.php:5923 (__construct) [id: 1834]
/classes/Product.php:5923 (__construct) [id: 1841]
/classes/Product.php:5923 (__construct) [id: 3880]
Address 4 /classes/shop/Shop.php:486 (__construct) [id: ]
/classes/Product.php:3694 (initialize) [id: ]
/classes/Product.php:3804 (__construct) [id: ]
/classes/Product.php:5975 (__construct) [id: ]
Currency 3 /src/Adapter/Currency/CurrencyDataProvider.php:101 (__construct) [id: 2]
/src/Adapter/Currency/CurrencyDataProvider.php:101 (__construct) [id: 1]
/classes/Tools.php:691 (getCurrencyInstance) [id: 2]
Country 3 /config/config.inc.php:146 (__construct) [id: 6]
/classes/AddressFormat.php:404 (__construct) [id: 6]
/classes/controller/FrontController.php:1769 (__construct) [id: 6]
State 2 /classes/AddressFormat.php:404 (__construct) [id: 362]
/classes/controller/FrontController.php:1768 (__construct) [id: 362]
Language 2 /config/config.inc.php:211 (__construct) [id: 2]
/classes/Tools.php:561 (__construct) [id: 2]
Cart 2 /classes/controller/FrontController.php:467 (__construct) [id: ]
/classes/controller/FrontController.php:541 (__construct) [id: ]
Tax 2 /classes/tax/TaxRulesTaxManager.php:116 (__construct) [id: 53]
/classes/tax/TaxRulesTaxManager.php:116 (__construct) [id: 53]
Shop 1 /config/config.inc.php:117 (initialize) [id: 1]
IqitElementorCategory 1 /modules/iqitelementor/iqitelementor.php:784 (isJustElementor) [id: ]
Configuration 1 /modules/ps_accounts/src/Adapter/Configuration.php:239 (__construct) [id: 1315]
Risk 1 /classes/controller/FrontController.php:1695 (__construct) [id: ]
AddressFormat 1 /classes/controller/FrontController.php:1763 (generateAddress) [id: ]
Gender 1 /classes/controller/FrontController.php:1692 (__construct) [id: 0]
Group 1 /classes/Cart.php:249 (getCurrent) [id: 1]
Customer 1 /config/config.inc.php:264 (__construct) [id: ]
ShopGroup 1 /classes/shop/Shop.php:561 (__construct) [id: 1]
ConnectionsSource 1 /modules/statsdata/statsdata.php:119 (logHttpReferer) [id: ]

Included Files

# Filename
0 /index.php
1 /config/config.inc.php
2 /config/defines.inc.php
3 /config/autoload.php
4 /vendor/autoload.php
5 /vendor/composer/autoload_real.php
6 /vendor/composer/platform_check.php
7 /vendor/composer/ClassLoader.php
8 /vendor/composer/include_paths.php
9 /vendor/composer/autoload_static.php
10 /vendor/symfony/polyfill-php72/bootstrap.php
11 /vendor/symfony/polyfill-mbstring/bootstrap.php
12 /vendor/symfony/polyfill-mbstring/bootstrap80.php
13 /vendor/symfony/polyfill-intl-normalizer/bootstrap.php
14 /vendor/symfony/polyfill-intl-normalizer/bootstrap80.php
15 /vendor/symfony/polyfill-intl-idn/bootstrap.php
16 /vendor/symfony/deprecation-contracts/function.php
17 /vendor/ralouphie/getallheaders/src/getallheaders.php
18 /vendor/symfony/polyfill-ctype/bootstrap.php
19 /vendor/symfony/polyfill-ctype/bootstrap80.php
20 /vendor/symfony/polyfill-php80/bootstrap.php
21 /vendor/guzzlehttp/promises/src/functions_include.php
22 /vendor/guzzlehttp/promises/src/functions.php
23 /vendor/guzzlehttp/guzzle/src/functions_include.php
24 /vendor/guzzlehttp/guzzle/src/functions.php
25 /vendor/symfony/polyfill-iconv/bootstrap.php
26 /vendor/ezyang/htmlpurifier/library/HTMLPurifier.composer.php
27 /vendor/jakeasmith/http_build_url/src/http_build_url.php
28 /vendor/lcobucci/jwt/compat/class-aliases.php
29 /vendor/lcobucci/jwt/src/Token.php
30 /vendor/lcobucci/jwt/src/Signature.php
31 /vendor/lcobucci/jwt/compat/json-exception-polyfill.php
32 /vendor/lcobucci/jwt/compat/lcobucci-clock-polyfill.php
33 /vendor/swiftmailer/swiftmailer/lib/swift_required.php
34 /vendor/swiftmailer/swiftmailer/lib/classes/Swift.php
35 /vendor/symfony/polyfill-intl-icu/bootstrap.php
36 /vendor/symfony/polyfill-php73/bootstrap.php
37 /vendor/symfony/polyfill-php81/bootstrap.php
38 /vendor/api-platform/core/src/deprecation.php
39 /vendor/api-platform/core/src/Api/FilterInterface.php
40 /vendor/api-platform/core/src/Api/ResourceClassResolverInterface.php
41 /vendor/api-platform/core/src/deprecated_interfaces.php
42 /vendor/api-platform/core/src/Metadata/Property/Factory/PropertyNameCollectionFactoryInterface.php
43 /vendor/api-platform/core/src/Metadata/Resource/Factory/ResourceNameCollectionFactoryInterface.php
44 /vendor/api-platform/core/src/Metadata/Extractor/ResourceExtractorInterface.php
45 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/DateFilterInterface.php
46 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/ExistsFilterInterface.php
47 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/OrderFilterInterface.php
48 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/RangeFilterInterface.php
49 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/SearchFilterInterface.php
50 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationCollectionExtensionInterface.php
51 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationItemExtensionInterface.php
52 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultCollectionExtensionInterface.php
53 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultItemExtensionInterface.php
54 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Filter/FilterInterface.php
55 /vendor/api-platform/core/src/Doctrine/Orm/QueryAwareInterface.php
56 /vendor/api-platform/core/src/Doctrine/Orm/Util/QueryNameGeneratorInterface.php
57 /vendor/api-platform/core/src/Elasticsearch/Metadata/Document/Factory/DocumentMetadataFactoryInterface.php
58 /vendor/api-platform/core/src/Symfony/Validator/ValidationGroupsGeneratorInterface.php
59 /vendor/api-platform/core/src/Symfony/Validator/Exception/ConstraintViolationListAwareExceptionInterface.php
60 /vendor/api-platform/core/src/Exception/ExceptionInterface.php
61 /vendor/api-platform/core/src/Core/Bridge/Symfony/Validator/Metadata/Property/Restriction/PropertySchemaRestrictionMetadataInterface.php
62 /vendor/api-platform/core/src/State/Pagination/PaginatorInterface.php
63 /vendor/api-platform/core/src/State/Pagination/PartialPaginatorInterface.php
64 /vendor/api-platform/core/src/Documentation/DocumentationInterface.php
65 /vendor/api-platform/core/src/JsonLd/AnonymousContextBuilderInterface.php
66 /vendor/api-platform/core/src/JsonLd/ContextBuilderInterface.php
67 /vendor/api-platform/core/src/Core/JsonSchema/SchemaFactoryInterface.php
68 /vendor/api-platform/core/src/JsonSchema/TypeFactoryInterface.php
69 /vendor/api-platform/core/src/OpenApi/Factory/OpenApiFactoryInterface.php
70 /vendor/api-platform/core/src/PathResolver/OperationPathResolverInterface.php
71 /vendor/api-platform/core/src/Symfony/Security/ResourceAccessCheckerInterface.php
72 /vendor/api-platform/core/src/Serializer/Filter/FilterInterface.php
73 /vendor/api-platform/core/src/Serializer/SerializerContextBuilderInterface.php
74 /vendor/api-platform/core/src/Validator/ValidatorInterface.php
75 /vendor/api-platform/core/src/Api/UrlGeneratorInterface.php
76 /vendor/api-platform/core/src/GraphQl/ExecutorInterface.php
77 /vendor/api-platform/core/src/GraphQl/Error/ErrorHandlerInterface.php
78 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ValidateStageInterface.php
79 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ReadStageInterface.php
80 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityPostDenormalizeStageInterface.php
81 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityStageInterface.php
82 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/WriteStageInterface.php
83 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SerializeStageInterface.php
84 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/DeserializeStageInterface.php
85 /vendor/api-platform/core/src/GraphQl/Resolver/QueryItemResolverInterface.php
86 /vendor/api-platform/core/src/GraphQl/Resolver/QueryCollectionResolverInterface.php
87 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Factory/ResolverFactoryInterface.php
88 /vendor/api-platform/core/src/GraphQl/Resolver/MutationResolverInterface.php
89 /vendor/api-platform/core/src/Core/GraphQl/Subscription/MercureSubscriptionIriGeneratorInterface.php
90 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionIdentifierGeneratorInterface.php
91 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionManagerInterface.php
92 /vendor/api-platform/core/src/Core/GraphQl/Serializer/SerializerContextBuilderInterface.php
93 /vendor/api-platform/core/src/GraphQl/Type/TypesFactoryInterface.php
94 /vendor/api-platform/core/src/GraphQl/Type/Definition/TypeInterface.php
95 /vendor/api-platform/core/src/GraphQl/Type/TypesContainerInterface.php
96 /vendor/psr/container/src/ContainerInterface.php
97 /vendor/api-platform/core/src/Operation/PathSegmentNameGeneratorInterface.php
98 /vendor/ircmaxell/password-compat/lib/password.php
99 /vendor/martinlindhe/php-mb-helpers/src/mb_helpers.php
100 /vendor/prestashop/laminas-code-lts/polyfill/ReflectionEnumPolyfill.php
101 /src/Core/Version.php
102 /config/alias.php
103 /vendor/prestashop/autoload/src/PrestashopAutoload.php
104 /vendor/prestashop/autoload/src/LegacyClassLoader.php
105 /vendor/symfony/symfony/src/Symfony/Component/Filesystem/Filesystem.php
106 /vendor/prestashop/autoload/src/Autoloader.php
107 /config/bootstrap.php
108 /src/Core/ContainerBuilder.php
109 /src/Core/Foundation/IoC/Container.php
110 /src/Adapter/ServiceLocator.php
111 /var/cache/prod/appParameters.php
114 /var/cache/prod/class_index.php
115 /classes/controller/Controller.php
117 /classes/ObjectModel.php
118 /src/Core/Foundation/Database/EntityInterface.php
120 /classes/db/Db.php
122 /classes/Hook.php
124 /classes/module/Module.php
125 /src/Core/Module/Legacy/ModuleInterface.php
127 /classes/Tools.php
128 /classes/Context.php
129 /classes/shop/Shop.php
130 /src/Core/Security/PasswordGenerator.php
131 /classes/db/DbPDO.php
132 /classes/AddressFormat.php
133 /classes/Configuration.php
134 /classes/Validate.php
135 /classes/cache/Cache.php
136 /src/Adapter/EntityMapper.php
137 /classes/db/DbQuery.php
138 /src/Core/Addon/Theme/ThemeManagerBuilder.php
139 /vendor/psr/log/Psr/Log/NullLogger.php
140 /vendor/psr/log/Psr/Log/AbstractLogger.php
141 /vendor/psr/log/Psr/Log/LoggerInterface.php
142 /src/Adapter/Configuration.php
143 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ParameterBag.php
144 /src/Core/Domain/Configuration/ShopConfigurationInterface.php
145 /src/Core/ConfigurationInterface.php
146 /src/Core/Addon/Theme/ThemeRepository.php
147 /src/Core/Addon/AddonRepositoryInterface.php
148 /src/Core/Domain/Shop/ValueObject/ShopConstraint.php
149 /src/Core/Addon/Theme/Theme.php
150 /src/Core/Addon/AddonInterface.php
151 /src/Core/Util/ArrayFinder.php
152 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccess.php
153 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorBuilder.php
154 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessor.php
155 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorInterface.php
156 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPath.php
157 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPathInterface.php
158 /config/defines_uri.inc.php
159 /classes/Language.php
160 /src/Core/Language/LanguageInterface.php
161 /classes/Country.php
162 /classes/PrestaShopCollection.php
163 /classes/shop/ShopGroup.php
164 /classes/Cookie.php
165 /classes/PhpEncryption.php
166 /classes/PhpEncryptionEngine.php
167 /vendor/defuse/php-encryption/src/Key.php
168 /vendor/defuse/php-encryption/src/Encoding.php
169 /vendor/defuse/php-encryption/src/Core.php
170 /vendor/defuse/php-encryption/src/Crypto.php
171 /vendor/defuse/php-encryption/src/KeyOrPassword.php
172 /vendor/defuse/php-encryption/src/RuntimeTests.php
173 /vendor/defuse/php-encryption/src/DerivedKeys.php
174 /vendor/defuse/php-encryption/src/Exception/WrongKeyOrModifiedCiphertextException.php
175 /vendor/defuse/php-encryption/src/Exception/CryptoException.php
176 /src/Core/Session/SessionHandler.php
177 /src/Core/Session/SessionHandlerInterface.php
178 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Session.php
179 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBag.php
180 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBagInterface.php
181 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagInterface.php
182 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBag.php
183 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBagInterface.php
184 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagProxy.php
185 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionInterface.php
186 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/PhpBridgeSessionStorage.php
187 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/NativeSessionStorage.php
188 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/MetadataBag.php
189 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/StrictSessionHandler.php
190 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/AbstractSessionHandler.php
191 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/SessionHandlerProxy.php
192 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/AbstractProxy.php
193 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/SessionStorageInterface.php
194 /config/smarty.config.inc.php
195 /vendor/smarty/smarty/libs/Smarty.class.php
196 /vendor/smarty/smarty/libs/functions.php
197 /vendor/smarty/smarty/libs/Autoloader.php
198 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_data.php
199 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_extension_handler.php
200 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php
201 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php
202 /vendor/smarty/smarty/libs/sysplugins/smarty_resource.php
203 /vendor/smarty/smarty/libs/sysplugins/smarty_variable.php
204 /vendor/smarty/smarty/libs/sysplugins/smarty_template_source.php
205 /vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php
206 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_resource_file.php
207 /config/smartyfront.config.inc.php
208 /classes/Smarty/SmartyResourceModule.php
209 /vendor/smarty/smarty/libs/sysplugins/smarty_resource_custom.php
210 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerresource.php
211 /classes/Smarty/SmartyResourceParent.php
212 /classes/Smarty/SmartyLazyRegister.php
213 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerplugin.php
214 /vendor/smarty/smarty/libs/plugins/modifier.truncate.php
215 /classes/Customer.php
216 /classes/Group.php
217 /classes/Link.php
218 /classes/shop/ShopUrl.php
219 /classes/Dispatcher.php
220 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Request.php
221 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeader.php
222 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeaderItem.php
223 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/FileBag.php
224 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderBag.php
225 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderUtils.php
226 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ServerBag.php
227 /src/Adapter/SymfonyContainer.php
228 /vendor/mobiledetect/mobiledetectlib/Mobile_Detect.php
229 /config/db_slave_server.inc.php
230 /src/Adapter/ContainerBuilder.php
231 /src/Adapter/Environment.php
232 /src/Core/EnvironmentInterface.php
233 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCache.php
234 /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerConfigCache.php
235 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheInterface.php
236 /vendor/symfony/symfony/src/Symfony/Component/Cache/DoctrineProvider.php
237 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/CacheProvider.php
238 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Cache.php
239 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/FlushableCache.php
240 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/ClearableCache.php
241 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiOperationCache.php
242 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiGetCache.php
243 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiDeleteCache.php
244 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiPutCache.php
245 /vendor/symfony/symfony/src/Symfony/Component/Cache/PruneableInterface.php
246 /vendor/symfony/symfony/src/Symfony/Component/Cache/ResettableInterface.php
247 /vendor/symfony/contracts/Service/ResetInterface.php
248 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/ArrayAdapter.php
249 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ArrayTrait.php
250 /vendor/psr/log/Psr/Log/LoggerAwareTrait.php
251 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AdapterInterface.php
252 /vendor/symfony/symfony/src/Symfony/Component/Cache/CacheItem.php
253 /vendor/symfony/contracts/Cache/ItemInterface.php
254 /vendor/psr/cache/src/CacheItemInterface.php
255 /vendor/psr/cache/src/CacheItemPoolInterface.php
256 /vendor/symfony/contracts/Cache/CacheInterface.php
257 /vendor/psr/log/Psr/Log/LoggerAwareInterface.php
258 /vendor/doctrine/orm/lib/Doctrine/ORM/Tools/Setup.php
259 /vendor/doctrine/deprecations/lib/Doctrine/Deprecations/Deprecation.php
260 /vendor/doctrine/orm/lib/Doctrine/ORM/Configuration.php
261 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Configuration.php
262 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/CacheAdapter.php
263 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/DoctrineProvider.php
264 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationReader.php
265 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Reader.php
266 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationRegistry.php
267 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/DoctrineAnnotations.php
268 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Annotation.php
269 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Entity.php
270 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embeddable.php
271 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embedded.php
272 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/MappedSuperclass.php
273 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/InheritanceType.php
274 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorColumn.php
275 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorMap.php
276 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Id.php
277 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/GeneratedValue.php
278 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Version.php
279 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumn.php
280 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumns.php
281 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Column.php
282 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToOne.php
283 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToMany.php
284 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToOne.php
285 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToMany.php
286 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Table.php
287 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/UniqueConstraint.php
288 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Index.php
289 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinTable.php
290 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SequenceGenerator.php
291 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/CustomIdGenerator.php
292 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ChangeTrackingPolicy.php
293 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OrderBy.php
294 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQueries.php
295 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQuery.php
296 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/HasLifecycleCallbacks.php
297 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PrePersist.php
298 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostPersist.php
299 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreUpdate.php
300 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostUpdate.php
301 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreRemove.php
302 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostRemove.php
303 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostLoad.php
304 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreFlush.php
305 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/FieldResult.php
306 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ColumnResult.php
307 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityResult.php
308 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQuery.php
309 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQueries.php
310 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMapping.php
311 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMappings.php
312 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverride.php
313 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverrides.php
314 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverride.php
315 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverrides.php
316 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityListeners.php
317 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Cache.php
318 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/SimpleAnnotationReader.php
319 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocParser.php
320 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocLexer.php
321 /vendor/doctrine/lexer/lib/Doctrine/Common/Lexer/AbstractLexer.php
322 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Target.php
323 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/AnnotationDriver.php
324 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/CompatibilityAnnotationDriver.php
325 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/MappingDriver.php
326 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/ColocatedMappingDriver.php
327 /var/cache/prod/FrontContainer.php
328 /src/Adapter/Container/LegacyContainer.php
329 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Container.php
330 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/RewindableGenerator.php
331 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/ServiceLocator.php
332 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ServiceLocator.php
333 /vendor/symfony/contracts/Service/ServiceLocatorTrait.php
334 /vendor/psr/container/src/ContainerExceptionInterface.php
335 /vendor/psr/container/src/NotFoundExceptionInterface.php
336 /vendor/symfony/contracts/Service/ServiceProviderInterface.php
337 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ResettableContainerInterface.php
338 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ContainerInterface.php
339 /src/Adapter/Container/LegacyContainerInterface.php
340 /modules/blockwishlist/vendor/autoload.php
341 /modules/blockwishlist/vendor/composer/autoload_real.php
342 /modules/blockwishlist/vendor/composer/autoload_static.php
343 /modules/contactform/vendor/autoload.php
344 /modules/contactform/vendor/composer/autoload_real.php
345 /modules/contactform/vendor/composer/autoload_static.php
346 /modules/dashactivity/vendor/autoload.php
347 /modules/dashactivity/vendor/composer/autoload_real.php
348 /modules/dashactivity/vendor/composer/autoload_static.php
349 /modules/dashtrends/vendor/autoload.php
350 /modules/dashtrends/vendor/composer/autoload_real.php
351 /modules/dashtrends/vendor/composer/autoload_static.php
352 /modules/dashgoals/vendor/autoload.php
353 /modules/dashgoals/vendor/composer/autoload_real.php
354 /modules/dashgoals/vendor/composer/autoload_static.php
355 /modules/dashproducts/vendor/autoload.php
356 /modules/dashproducts/vendor/composer/autoload_real.php
357 /modules/dashproducts/vendor/composer/platform_check.php
358 /modules/dashproducts/vendor/composer/autoload_static.php
359 /modules/graphnvd3/vendor/autoload.php
360 /modules/graphnvd3/vendor/composer/autoload_real.php
361 /modules/graphnvd3/vendor/composer/autoload_static.php
362 /modules/gridhtml/vendor/autoload.php
363 /modules/gridhtml/vendor/composer/autoload_real.php
364 /modules/gridhtml/vendor/composer/autoload_static.php
365 /modules/gsitemap/vendor/autoload.php
366 /modules/gsitemap/vendor/composer/autoload_real.php
367 /modules/gsitemap/vendor/composer/platform_check.php
368 /modules/gsitemap/vendor/composer/autoload_static.php
369 /modules/pagesnotfound/vendor/autoload.php
370 /modules/pagesnotfound/vendor/composer/autoload_real.php
371 /modules/pagesnotfound/vendor/composer/platform_check.php
372 /modules/pagesnotfound/vendor/composer/autoload_static.php
373 /modules/productcomments/vendor/autoload.php
374 /modules/productcomments/vendor/composer/autoload_real.php
375 /modules/productcomments/vendor/composer/platform_check.php
376 /modules/productcomments/vendor/composer/autoload_static.php
377 /modules/ps_checkpayment/vendor/autoload.php
378 /modules/ps_checkpayment/vendor/composer/autoload_real.php
379 /modules/ps_checkpayment/vendor/composer/autoload_static.php
380 /modules/ps_contactinfo/vendor/autoload.php
381 /modules/ps_contactinfo/vendor/composer/autoload_real.php
382 /modules/ps_contactinfo/vendor/composer/autoload_static.php
383 /modules/ps_crossselling/vendor/autoload.php
384 /modules/ps_crossselling/vendor/composer/autoload_real.php
385 /modules/ps_crossselling/vendor/composer/platform_check.php
386 /modules/ps_crossselling/vendor/composer/autoload_static.php
387 /modules/ps_currencyselector/vendor/autoload.php
388 /modules/ps_currencyselector/vendor/composer/autoload_real.php
389 /modules/ps_currencyselector/vendor/composer/autoload_static.php
390 /modules/ps_customeraccountlinks/vendor/autoload.php
391 /modules/ps_customeraccountlinks/vendor/composer/autoload_real.php
392 /modules/ps_customeraccountlinks/vendor/composer/autoload_static.php
393 /modules/ps_customtext/vendor/autoload.php
394 /modules/ps_customtext/vendor/composer/autoload_real.php
395 /modules/ps_customtext/vendor/composer/platform_check.php
396 /modules/ps_customtext/vendor/composer/autoload_static.php
397 /modules/ps_dataprivacy/vendor/autoload.php
398 /modules/ps_dataprivacy/vendor/composer/autoload_real.php
399 /modules/ps_dataprivacy/vendor/composer/autoload_static.php
400 /modules/ps_emailsubscription/vendor/autoload.php
401 /modules/ps_emailsubscription/vendor/composer/autoload_real.php
402 /modules/ps_emailsubscription/vendor/composer/platform_check.php
403 /modules/ps_emailsubscription/vendor/composer/autoload_static.php
404 /modules/ps_faviconnotificationbo/vendor/autoload.php
405 /modules/ps_faviconnotificationbo/vendor/composer/autoload_real.php
406 /modules/ps_faviconnotificationbo/vendor/composer/platform_check.php
407 /modules/ps_faviconnotificationbo/vendor/composer/autoload_static.php
408 /modules/ps_featuredproducts/vendor/autoload.php
409 /modules/ps_featuredproducts/vendor/composer/autoload_real.php
410 /modules/ps_featuredproducts/vendor/composer/platform_check.php
411 /modules/ps_featuredproducts/vendor/composer/autoload_static.php
412 /modules/ps_imageslider/vendor/autoload.php
413 /modules/ps_imageslider/vendor/composer/autoload_real.php
414 /modules/ps_imageslider/vendor/composer/platform_check.php
415 /modules/ps_imageslider/vendor/composer/autoload_static.php
416 /modules/ps_languageselector/vendor/autoload.php
417 /modules/ps_languageselector/vendor/composer/autoload_real.php
418 /modules/ps_languageselector/vendor/composer/autoload_static.php
419 /modules/ps_linklist/vendor/autoload.php
420 /modules/ps_linklist/vendor/composer/autoload_real.php
421 /modules/ps_linklist/vendor/composer/autoload_static.php
422 /modules/ps_mainmenu/vendor/autoload.php
423 /modules/ps_mainmenu/vendor/composer/autoload_real.php
424 /modules/ps_mainmenu/vendor/composer/platform_check.php
425 /modules/ps_mainmenu/vendor/composer/autoload_static.php
426 /modules/ps_searchbar/vendor/autoload.php
427 /modules/ps_searchbar/vendor/composer/autoload_real.php
428 /modules/ps_searchbar/vendor/composer/autoload_static.php
429 /modules/ps_sharebuttons/vendor/autoload.php
430 /modules/ps_sharebuttons/vendor/composer/autoload_real.php
431 /modules/ps_sharebuttons/vendor/composer/autoload_static.php
432 /modules/ps_shoppingcart/vendor/autoload.php
433 /modules/ps_shoppingcart/vendor/composer/autoload_real.php
434 /modules/ps_shoppingcart/vendor/composer/autoload_static.php
435 /modules/ps_socialfollow/vendor/autoload.php
436 /modules/ps_socialfollow/vendor/composer/autoload_real.php
437 /modules/ps_socialfollow/vendor/composer/platform_check.php
438 /modules/ps_socialfollow/vendor/composer/autoload_static.php
439 /modules/ps_themecusto/vendor/autoload.php
440 /modules/ps_themecusto/vendor/composer/autoload_real.php
441 /modules/ps_themecusto/vendor/composer/autoload_static.php
442 /modules/ps_wirepayment/vendor/autoload.php
443 /modules/ps_wirepayment/vendor/composer/autoload_real.php
444 /modules/ps_wirepayment/vendor/composer/platform_check.php
445 /modules/ps_wirepayment/vendor/composer/autoload_static.php
446 /modules/statsbestcategories/vendor/autoload.php
447 /modules/statsbestcategories/vendor/composer/autoload_real.php
448 /modules/statsbestcategories/vendor/composer/platform_check.php
449 /modules/statsbestcategories/vendor/composer/autoload_static.php
450 /modules/statsbestcustomers/vendor/autoload.php
451 /modules/statsbestcustomers/vendor/composer/autoload_real.php
452 /modules/statsbestcustomers/vendor/composer/platform_check.php
453 /modules/statsbestcustomers/vendor/composer/autoload_static.php
454 /modules/statsbestproducts/vendor/autoload.php
455 /modules/statsbestproducts/vendor/composer/autoload_real.php
456 /modules/statsbestproducts/vendor/composer/platform_check.php
457 /modules/statsbestproducts/vendor/composer/autoload_static.php
458 /modules/statsbestsuppliers/vendor/autoload.php
459 /modules/statsbestsuppliers/vendor/composer/autoload_real.php
460 /modules/statsbestsuppliers/vendor/composer/platform_check.php
461 /modules/statsbestsuppliers/vendor/composer/autoload_static.php
462 /modules/statsbestvouchers/vendor/autoload.php
463 /modules/statsbestvouchers/vendor/composer/autoload_real.php
464 /modules/statsbestvouchers/vendor/composer/platform_check.php
465 /modules/statsbestvouchers/vendor/composer/autoload_static.php
466 /modules/statscarrier/vendor/autoload.php
467 /modules/statscarrier/vendor/composer/autoload_real.php
468 /modules/statscarrier/vendor/composer/platform_check.php
469 /modules/statscarrier/vendor/composer/autoload_static.php
470 /modules/statscatalog/vendor/autoload.php
471 /modules/statscatalog/vendor/composer/autoload_real.php
472 /modules/statscatalog/vendor/composer/platform_check.php
473 /modules/statscatalog/vendor/composer/autoload_static.php
474 /modules/statscheckup/vendor/autoload.php
475 /modules/statscheckup/vendor/composer/autoload_real.php
476 /modules/statscheckup/vendor/composer/platform_check.php
477 /modules/statscheckup/vendor/composer/autoload_static.php
478 /modules/statsdata/vendor/autoload.php
479 /modules/statsdata/vendor/composer/autoload_real.php
480 /modules/statsdata/vendor/composer/platform_check.php
481 /modules/statsdata/vendor/composer/autoload_static.php
482 /modules/statsforecast/vendor/autoload.php
483 /modules/statsforecast/vendor/composer/autoload_real.php
484 /modules/statsforecast/vendor/composer/platform_check.php
485 /modules/statsforecast/vendor/composer/autoload_static.php
486 /modules/statsnewsletter/vendor/autoload.php
487 /modules/statsnewsletter/vendor/composer/autoload_real.php
488 /modules/statsnewsletter/vendor/composer/platform_check.php
489 /modules/statsnewsletter/vendor/composer/autoload_static.php
490 /modules/statspersonalinfos/vendor/autoload.php
491 /modules/statspersonalinfos/vendor/composer/autoload_real.php
492 /modules/statspersonalinfos/vendor/composer/platform_check.php
493 /modules/statspersonalinfos/vendor/composer/autoload_static.php
494 /modules/statsproduct/vendor/autoload.php
495 /modules/statsproduct/vendor/composer/autoload_real.php
496 /modules/statsproduct/vendor/composer/platform_check.php
497 /modules/statsproduct/vendor/composer/autoload_static.php
498 /modules/statsregistrations/vendor/autoload.php
499 /modules/statsregistrations/vendor/composer/autoload_real.php
500 /modules/statsregistrations/vendor/composer/platform_check.php
501 /modules/statsregistrations/vendor/composer/autoload_static.php
502 /modules/statssales/vendor/autoload.php
503 /modules/statssales/vendor/composer/autoload_real.php
504 /modules/statssales/vendor/composer/platform_check.php
505 /modules/statssales/vendor/composer/autoload_static.php
506 /modules/statssearch/vendor/autoload.php
507 /modules/statssearch/vendor/composer/autoload_real.php
508 /modules/statssearch/vendor/composer/platform_check.php
509 /modules/statssearch/vendor/composer/autoload_static.php
510 /modules/statsstock/vendor/autoload.php
511 /modules/statsstock/vendor/composer/autoload_real.php
512 /modules/statsstock/vendor/composer/platform_check.php
513 /modules/statsstock/vendor/composer/autoload_static.php
514 /modules/psgdpr/vendor/autoload.php
515 /modules/psgdpr/vendor/composer/autoload_real.php
516 /modules/psgdpr/vendor/composer/autoload_static.php
517 /modules/ps_metrics/vendor/autoload.php
518 /modules/ps_metrics/vendor/composer/autoload_real.php
519 /modules/ps_metrics/vendor/composer/autoload_static.php
520 /modules/ps_metrics/vendor/symfony/polyfill-php80/bootstrap.php
521 /modules/ps_metrics/vendor/symfony/deprecation-contracts/function.php
522 /modules/ps_metrics/vendor/symfony/polyfill-mbstring/bootstrap.php
523 /modules/ps_metrics/vendor/symfony/polyfill-mbstring/bootstrap80.php
524 /modules/ps_metrics/vendor/symfony/polyfill-ctype/bootstrap.php
525 /modules/ps_metrics/vendor/symfony/polyfill-ctype/bootstrap80.php
526 /modules/ps_metrics/vendor/symfony/polyfill-php73/bootstrap.php
527 /modules/ps_metrics/vendor/symfony/polyfill-intl-grapheme/bootstrap.php
528 /modules/ps_metrics/vendor/symfony/polyfill-intl-normalizer/bootstrap.php
529 /modules/ps_metrics/vendor/symfony/polyfill-intl-normalizer/bootstrap80.php
530 /modules/ps_metrics/vendor/symfony/string/Resources/functions.php
531 /modules/ps_metrics/vendor/clue/stream-filter/src/functions_include.php
532 /modules/ps_metrics/vendor/clue/stream-filter/src/functions.php
533 /modules/ps_metrics/vendor/ralouphie/getallheaders/src/getallheaders.php
534 /modules/ps_metrics/vendor/guzzlehttp/psr7/src/functions_include.php
535 /modules/ps_metrics/vendor/guzzlehttp/psr7/src/functions.php
536 /modules/ps_metrics/vendor/php-http/message/src/filters.php
537 /modules/ps_metrics/vendor/symfony/polyfill-php81/bootstrap.php
538 /modules/ps_metrics/vendor/phpstan/phpstan/bootstrap.php
539 /modules/ps_metrics/vendor/segmentio/analytics-php/lib/Segment.php
540 /modules/ps_metrics/vendor/segmentio/analytics-php/lib/Segment/Client.php
541 /modules/ps_metrics/vendor/segmentio/analytics-php/lib/Segment/Consumer.php
542 /modules/ps_metrics/vendor/segmentio/analytics-php/lib/Segment/QueueConsumer.php
543 /modules/ps_metrics/vendor/segmentio/analytics-php/lib/Segment/Consumer/File.php
544 /modules/ps_metrics/vendor/segmentio/analytics-php/lib/Segment/Consumer/ForkCurl.php
545 /modules/ps_metrics/vendor/segmentio/analytics-php/lib/Segment/Consumer/Socket.php
546 /modules/ps_facebook/vendor/autoload.php
547 /modules/ps_facebook/vendor/composer/autoload_real.php
548 /modules/ps_facebook/vendor/composer/autoload_static.php
549 /modules/ps_facebook/vendor/segmentio/analytics-php/lib/Segment.php
550 /modules/ps_facebook/vendor/segmentio/analytics-php/lib/Segment/Client.php
551 /modules/ps_facebook/vendor/segmentio/analytics-php/lib/Segment/Consumer.php
552 /modules/ps_facebook/vendor/segmentio/analytics-php/lib/Segment/QueueConsumer.php
553 /modules/ps_facebook/vendor/segmentio/analytics-php/lib/Segment/Consumer/File.php
554 /modules/ps_facebook/vendor/segmentio/analytics-php/lib/Segment/Consumer/ForkCurl.php
555 /modules/ps_facebook/vendor/segmentio/analytics-php/lib/Segment/Consumer/LibCurl.php
556 /modules/ps_facebook/vendor/segmentio/analytics-php/lib/Segment/Consumer/Socket.php
557 /modules/ps_facebook/vendor/segmentio/analytics-php/lib/Segment/Version.php
558 /modules/psxmarketingwithgoogle/vendor/autoload.php
559 /modules/psxmarketingwithgoogle/vendor/composer/autoload_real.php
560 /modules/psxmarketingwithgoogle/vendor/composer/autoload_static.php
561 /modules/blockreassurance/vendor/autoload.php
562 /modules/blockreassurance/vendor/composer/autoload_real.php
563 /modules/blockreassurance/vendor/composer/autoload_static.php
564 /modules/ps_facetedsearch/vendor/autoload.php
565 /modules/ps_facetedsearch/vendor/composer/autoload_real.php
566 /modules/ps_facetedsearch/vendor/composer/platform_check.php
567 /modules/ps_facetedsearch/vendor/composer/autoload_static.php
568 /modules/ps_emailalerts/vendor/autoload.php
569 /modules/ps_emailalerts/vendor/composer/autoload_real.php
570 /modules/ps_emailalerts/vendor/composer/autoload_static.php
571 /modules/ps_categorytree/vendor/autoload.php
572 /modules/ps_categorytree/vendor/composer/autoload_real.php
573 /modules/ps_categorytree/vendor/composer/platform_check.php
574 /modules/ps_categorytree/vendor/composer/autoload_static.php
575 /modules/ps_distributionapiclient/vendor/autoload.php
576 /modules/ps_distributionapiclient/vendor/composer/autoload_real.php
577 /modules/ps_distributionapiclient/vendor/composer/platform_check.php
578 /modules/ps_distributionapiclient/vendor/composer/autoload_static.php
579 /modules/ps_distributionapiclient/vendor/symfony/polyfill-intl-grapheme/bootstrap.php
580 /modules/ps_distributionapiclient/vendor/symfony/string/Resources/functions.php
581 /src/Core/Hook/HookModuleFilter.php
582 /src/Core/Hook/HookModuleFilterInterface.php
583 /controllers/front/listing/CategoryController.php
584 /classes/controller/ProductListingFrontController.php
585 /classes/controller/ProductPresentingFrontController.php
586 /classes/controller/FrontController.php
587 /src/PrestaShopBundle/Translation/TranslatorComponent.php
588 /vendor/symfony/symfony/src/Symfony/Component/Translation/Translator.php
589 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorInterface.php
590 /vendor/symfony/contracts/Translation/LocaleAwareInterface.php
591 /vendor/symfony/contracts/Translation/TranslatorInterface.php
592 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorBagInterface.php
593 /src/PrestaShopBundle/Translation/PrestaShopTranslatorTrait.php
594 /src/PrestaShopBundle/Translation/TranslatorLanguageTrait.php
595 /src/PrestaShopBundle/Translation/TranslatorInterface.php
596 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatter.php
597 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatter.php
598 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatterInterface.php
599 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatterInterface.php
600 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/ChoiceMessageFormatterInterface.php
601 /vendor/symfony/symfony/src/Symfony/Component/Translation/IdentityTranslator.php
602 /vendor/symfony/contracts/Translation/TranslatorTrait.php
603 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactory.php
604 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactoryInterface.php
605 /var/cache/prod/translations/catalogue.es-ES.NXhscRe.php
606 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogue.php
607 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogueInterface.php
608 /vendor/symfony/symfony/src/Symfony/Component/Translation/MetadataAwareInterface.php
609 /src/Adapter/Presenter/Object/ObjectPresenter.php
610 /src/Adapter/Presenter/PresenterInterface.php
611 /src/Adapter/Presenter/Cart/CartPresenter.php
612 /src/Adapter/Image/ImageRetriever.php
613 /classes/tax/TaxConfiguration.php
614 /classes/Smarty/TemplateFinder.php
615 /classes/assets/StylesheetManager.php
616 /classes/assets/AbstractAssetManager.php
617 /src/Adapter/Assets/AssetUrlGeneratorTrait.php
618 /classes/assets/JavascriptManager.php
619 /classes/assets/CccReducer.php
620 /modules/iqitthemeeditor/iqitthemeeditor.php
621 /modules/iqitthemeeditor/src/IqitSmartyModifiers.php
622 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_createdata.php
623 /vendor/smarty/smarty/libs/sysplugins/smarty_data.php
624 /classes/Translate.php
625 /modules/iqitthemeeditor/translations/es.php
626 /classes/Category.php
627 /classes/webservice/WebserviceRequest.php
628 /src/Core/Localization/Locale/Repository.php
629 /src/Core/Localization/Locale/RepositoryInterface.php
630 /src/Core/Localization/CLDR/LocaleRepository.php
631 /src/Core/Localization/CLDR/LocaleDataSource.php
632 /src/Core/Localization/CLDR/DataLayer/LocaleCache.php
633 /src/Core/Data/Layer/AbstractDataLayer.php
634 /src/Core/Localization/CLDR/LocaleDataLayerInterface.php
635 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/FilesystemAdapter.php
636 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AbstractAdapter.php
637 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractAdapterTrait.php
638 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractTrait.php
639 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ContractsTrait.php
640 /vendor/symfony/contracts/Cache/CacheTrait.php
641 /vendor/psr/cache/src/InvalidArgumentException.php
642 /vendor/psr/cache/src/CacheException.php
643 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemTrait.php
644 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemCommonTrait.php
645 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/DefaultMarshaller.php
646 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/MarshallerInterface.php
647 /src/Core/Localization/CLDR/DataLayer/LocaleReference.php
648 /src/Core/Localization/CLDR/Reader.php
649 /src/Core/Localization/CLDR/ReaderInterface.php
650 /src/Core/Localization/Currency/Repository.php
651 /src/Core/Localization/Currency/RepositoryInterface.php
652 /src/Core/Localization/Currency/CurrencyDataSource.php
653 /src/Core/Localization/Currency/DataSourceInterface.php
654 /src/Core/Localization/Currency/DataLayer/CurrencyCache.php
655 /src/Core/Localization/Currency/CurrencyDataLayerInterface.php
656 /src/Core/Localization/Currency/DataLayer/CurrencyDatabase.php
657 /src/Adapter/Currency/CurrencyDataProvider.php
658 /src/Core/Currency/CurrencyDataProviderInterface.php
659 /src/Adapter/LegacyContext.php
660 /src/Adapter/Tools.php
661 /src/Core/Localization/Currency/DataLayer/CurrencyReference.php
662 /src/Core/Localization/Currency/DataLayer/CurrencyInstalled.php
663 /vendor/prestashop/decimal/src/Operation/Rounding.php
664 /src/Core/Localization/Locale.php
665 /src/Core/Localization/LocaleInterface.php
666 /src/Core/Localization/Specification/Price.php
667 /src/Core/Localization/Specification/Number.php
668 /src/Core/Localization/Specification/NumberInterface.php
669 /src/Core/Localization/Specification/Factory.php
670 /src/Core/Localization/CLDR/LocaleData.php
671 /src/Core/Localization/CLDR/NumberSymbolsData.php
672 /src/Core/Localization/CLDR/CurrencyData.php
673 /src/Core/Localization/CLDR/Locale.php
674 /src/Core/Localization/CLDR/LocaleInterface.php
675 /src/Core/Localization/Specification/NumberSymbolList.php
676 /classes/Currency.php
677 /src/Core/Localization/Currency/LocalizedCurrencyId.php
678 /src/Core/Localization/Currency/CurrencyData.php
679 /src/Core/Localization/Currency/CurrencyCollection.php
680 /src/Core/Localization/Currency.php
681 /src/Core/Localization/CurrencyInterface.php
682 /src/Core/Localization/Specification/NumberCollection.php
683 /src/Core/Localization/Number/Formatter.php
684 /classes/Cart.php
685 /src/Adapter/AddressFactory.php
686 /classes/CartRule.php
687 /classes/Product.php
688 /src/Core/Domain/Product/ValueObject/RedirectType.php
689 /src/Core/Util/DateTime/DateTime.php
690 /src/Core/Domain/Product/Stock/ValueObject/OutOfStockType.php
691 /src/Core/Domain/Product/Pack/ValueObject/PackStockType.php
692 /src/Core/Domain/Product/ValueObject/ProductType.php
693 /src/Core/Domain/Product/ValueObject/Reference.php
694 /src/Core/Domain/Product/ValueObject/Ean13.php
695 /src/Core/Domain/Product/ValueObject/Isbn.php
696 /src/Core/Domain/Product/ValueObject/Upc.php
697 /src/Core/Domain/Product/ProductSettings.php
698 /src/Core/Image/ImageFormatConfiguration.php
699 /src/Core/Image/ImageFormatConfigurationInterface.php
700 /classes/FeatureFlag.php
701 /src/Core/FeatureFlag/FeatureFlagSettings.php
702 /classes/ImageType.php
703 /src/Core/Domain/Shop/ValueObject/ShopId.php
704 /src/Core/Domain/Shop/ValueObject/ShopIdInterface.php
705 /modules/ps_emailsubscription/ps_emailsubscription.php
706 /src/Core/Module/WidgetInterface.php
707 /src/PrestaShopBundle/Translation/DomainNormalizer.php
708 /classes/Media.php
709 /modules/ps_facebook/ps_facebook.php
710 /modules/ps_facebook/translations/es.php
711 /modules/ps_metrics/vendor/prestashop/module-lib-service-container/src/DependencyInjection/ServiceContainer.php
712 /modules/ps_metrics/vendor/prestashop/module-lib-cache-directory-provider/src/Cache/CacheDirectoryProvider.php
713 /modules/ps_metrics/vendor/prestashop/module-lib-service-container/src/DependencyInjection/ContainerProvider.php
714 /var/cache/prod/Ps_facebookFrontContainer.php
715 /modules/ps_facebook/classes/Buffer/TemplateBuffer.php
716 /modules/ps_emailalerts/ps_emailalerts.php
717 /modules/ps_emailalerts/MailAlert.php
718 /src/Adapter/Presenter/Cart/CartLazyArray.php
719 /src/Adapter/Presenter/AbstractLazyArray.php
720 /src/Adapter/Product/PriceFormatter.php
721 /src/Core/Util/Inflector.php
722 /vendor/doctrine/inflector/lib/Doctrine/Inflector/InflectorFactory.php
723 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Language.php
724 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/InflectorFactory.php
725 /vendor/doctrine/inflector/lib/Doctrine/Inflector/GenericLanguageInflectorFactory.php
726 /vendor/doctrine/inflector/lib/Doctrine/Inflector/LanguageInflectorFactory.php
727 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Rules.php
728 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Ruleset.php
729 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformations.php
730 /vendor/doctrine/inflector/lib/Doctrine/Inflector/WordInflector.php
731 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Inflectible.php
732 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformation.php
733 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Pattern.php
734 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Patterns.php
735 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Uninflected.php
736 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitutions.php
737 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitution.php
738 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Word.php
739 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Inflector.php
740 /vendor/doctrine/inflector/lib/Doctrine/Inflector/CachedWordInflector.php
741 /vendor/doctrine/inflector/lib/Doctrine/Inflector/RulesetInflector.php
742 /classes/Gender.php
743 /classes/Risk.php
744 /classes/Meta.php
745 /classes/Address.php
746 /classes/State.php
747 /src/Core/Security/PasswordPolicyConfiguration.php
748 /src/Core/Configuration/DataConfigurationInterface.php
749 /src/Core/Security/Hashing.php
750 /src/Core/Filter/FrontEndObject/MainFilter.php
751 /src/Core/Filter/FilterInterface.php
752 /src/Core/Filter/FrontEndObject/CartFilter.php
753 /src/Core/Filter/HashMapWhitelistFilter.php
754 /src/Core/Filter/CollectionFilter.php
755 /src/Core/Filter/FrontEndObject/ProductFilter.php
756 /src/Core/Filter/FrontEndObject/EmbeddedAttributesFilter.php
757 /src/Core/Filter/FrontEndObject/CustomerFilter.php
758 /src/Core/Filter/FrontEndObject/ShopFilter.php
759 /src/Core/Filter/FrontEndObject/ConfigurationFilter.php
760 /modules/productcomments/productcomments.php
761 /modules/ps_shoppingcart/ps_shoppingcart.php
762 /modules/ps_facebook/classes/Handler/ErrorHandler/ErrorHandler.php
763 /modules/ps_facebook/classes/Config/Env.php
764 /modules/ps_facebook/classes/Handler/ErrorHandler/ModuleFilteredRavenClient.php
765 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/Client.php
766 /modules/ps_facebook/classes/Config/Config.php
767 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/Util.php
768 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/Compat.php
769 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/Processor/SanitizeDataProcessor.php
770 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/Processor.php
771 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/Context.php
772 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/Breadcrumbs.php
773 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/Serializer.php
774 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/ReprSerializer.php
775 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/TransactionStack.php
776 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/Breadcrumbs/ErrorHandler.php
777 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/Stacktrace.php
778 /modules/ps_facebook/vendor/prestashop/prestashop-accounts-installer/src/Installer/Facade/PsAccounts.php
779 /modules/ps_facebook/vendor/prestashop/prestashop-accounts-installer/src/Installer/Installer.php
780 /src/Core/Addon/Module/ModuleManagerBuilder.php
781 /src/Core/Util/File/YamlParser.php
782 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/SelfCheckingResourceChecker.php
783 /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerInterface.php
784 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/FileResource.php
785 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/SelfCheckingResourceInterface.php
786 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/ResourceInterface.php
787 /var/cache/prod/yaml/b57b1d618dfd4975fcf38dbdde58e4aa.php
788 /src/Adapter/LegacyLogger.php
789 /src/PrestaShopBundle/Service/DataProvider/Admin/CategoriesProvider.php
790 /src/Adapter/Module/ModuleDataProvider.php
791 /src/Adapter/Module/AdminModuleDataProvider.php
792 /src/PrestaShopBundle/Service/DataProvider/Admin/ModuleInterface.php
793 /src/Adapter/Module/Module.php
794 /src/Core/Module/ModuleInterface.php
795 /vendor/symfony/symfony/src/Symfony/Component/Config/FileLocator.php
796 /vendor/symfony/symfony/src/Symfony/Component/Config/FileLocatorInterface.php
797 /vendor/symfony/symfony/src/Symfony/Component/Routing/Loader/YamlFileLoader.php
798 /vendor/symfony/symfony/src/Symfony/Component/Config/Loader/FileLoader.php
799 /vendor/symfony/symfony/src/Symfony/Component/Config/Loader/Loader.php
800 /vendor/symfony/symfony/src/Symfony/Component/Config/Loader/LoaderInterface.php
801 /vendor/symfony/symfony/src/Symfony/Component/Routing/Router.php
802 /vendor/symfony/symfony/src/Symfony/Component/Routing/RouterInterface.php
803 /vendor/symfony/symfony/src/Symfony/Component/Routing/Matcher/UrlMatcherInterface.php
804 /vendor/symfony/symfony/src/Symfony/Component/Routing/RequestContextAwareInterface.php
805 /vendor/symfony/symfony/src/Symfony/Component/Routing/Generator/UrlGeneratorInterface.php
806 /vendor/symfony/symfony/src/Symfony/Component/Routing/Matcher/RequestMatcherInterface.php
807 /vendor/symfony/symfony/src/Symfony/Component/Routing/RequestContext.php
808 /src/Adapter/Module/ModuleDataUpdater.php
809 /src/Core/Module/ModuleManager.php
810 /src/Core/Module/ModuleManagerInterface.php
811 /src/Core/Module/ModuleRepository.php
812 /src/Core/Module/ModuleRepositoryInterface.php
813 /src/Adapter/HookManager.php
814 /src/Core/Module/SourceHandler/SourceHandlerFactory.php
815 /src/PrestaShopBundle/Event/Dispatcher/NullDispatcher.php
816 /vendor/symfony/symfony/src/Symfony/Component/EventDispatcher/EventDispatcherInterface.php
817 /vendor/symfony/contracts/EventDispatcher/EventDispatcherInterface.php
818 /modules/ps_metrics/vendor/psr/event-dispatcher/src/EventDispatcherInterface.php
819 /src/Core/Hook/HookDispatcherInterface.php
820 /modules/ps_accounts/ps_accounts.php
821 /modules/ps_accounts/vendor/autoload.php
822 /modules/ps_accounts/vendor/composer/autoload_real.php
823 /modules/ps_accounts/vendor/composer/platform_check.php
824 /modules/ps_accounts/vendor/composer/autoload_static.php
825 /modules/ps_accounts/vendor/paragonie/random_compat/lib/random.php
826 /modules/ps_accounts/vendor/symfony/polyfill-ctype/bootstrap.php
827 /modules/ps_accounts/vendor/lcobucci/jwt/compat/class-aliases.php
828 /modules/ps_accounts/vendor/lcobucci/jwt/src/Token.php
829 /modules/ps_accounts/vendor/lcobucci/jwt/src/Signature.php
830 /modules/ps_accounts/vendor/lcobucci/jwt/compat/json-exception-polyfill.php
831 /modules/ps_accounts/vendor/lcobucci/jwt/compat/lcobucci-clock-polyfill.php
832 /modules/ps_accounts/vendor/ramsey/uuid/src/functions.php
833 /modules/ps_accounts/src/Hook/HookableTrait.php
834 /modules/ps_accounts/src/Module/Install.php
835 /modules/ps_accounts/src/Settings/SettingsForm.php
836 /modules/ps_accounts/translations/es.php
837 /modules/ps_accounts/src/ServiceContainer/PsAccountsContainer.php
838 /modules/ps_accounts/vendor/prestashopcorp/lightweight-container/src/ServiceContainer/ServiceContainer.php
839 /modules/ps_accounts/config.php
840 /modules/ps_accounts/src/Log/Logger.php
841 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Logger.php
842 /modules/ps_accounts/vendor/psr/log/Psr/Log/LoggerInterface.php
843 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/ResettableInterface.php
844 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Handler/RotatingFileHandler.php
845 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Handler/StreamHandler.php
846 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Handler/AbstractProcessingHandler.php
847 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Handler/AbstractHandler.php
848 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Handler/HandlerInterface.php
849 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Utils.php
850 /modules/ps_accounts/src/ServiceProvider/ApiClientProvider.php
851 /modules/ps_accounts/vendor/prestashopcorp/lightweight-container/src/ServiceContainer/Contract/IServiceProvider.php
852 /modules/ps_accounts/src/ServiceProvider/CommandProvider.php
853 /modules/ps_accounts/src/ServiceProvider/DefaultProvider.php
854 /modules/ps_accounts/src/ServiceProvider/OAuth2Provider.php
855 /modules/ps_accounts/src/ServiceProvider/QueryProvider.php
856 /modules/ps_accounts/src/ServiceProvider/RepositoryProvider.php
857 /modules/ps_accounts/src/ServiceProvider/SessionProvider.php
858 /modules/ps_accounts/src/Service/PsAccountsService.php
859 /modules/ps_accounts/src/Account/Session/ShopSession.php
860 /modules/ps_accounts/src/Account/Session/Session.php
861 /modules/ps_accounts/src/Account/Session/SessionInterface.php
862 /modules/ps_accounts/src/Repository/ConfigurationRepository.php
863 /modules/ps_accounts/src/Adapter/Configuration.php
864 /modules/ps_accounts/src/Service/OAuth2/OAuth2Service.php
865 /modules/ps_accounts/src/Http/Client/ClientConfig.php
866 /modules/ps_accounts/src/Http/Client/ConfigObject.php
867 /modules/ps_accounts/src/Type/Enum.php
868 /modules/ps_accounts/src/Service/OAuth2/OAuth2Client.php
869 /modules/ps_accounts/src/Adapter/Link.php
870 /modules/ps_accounts/src/Context/ShopContext.php
871 /modules/ps_accounts/vendor/ramsey/uuid/src/Uuid.php
872 /modules/ps_accounts/vendor/ramsey/uuid/src/UuidInterface.php
873 /modules/ps_accounts/vendor/ramsey/uuid/src/UuidFactory.php
874 /modules/ps_accounts/vendor/ramsey/uuid/src/UuidFactoryInterface.php
875 /modules/ps_accounts/vendor/ramsey/uuid/src/FeatureSet.php
876 /modules/ps_accounts/vendor/ramsey/uuid/src/Converter/Number/DegradedNumberConverter.php
877 /modules/ps_accounts/vendor/ramsey/uuid/src/Converter/NumberConverterInterface.php
878 /modules/ps_accounts/vendor/ramsey/uuid/src/Builder/DefaultUuidBuilder.php
879 /modules/ps_accounts/vendor/ramsey/uuid/src/Builder/UuidBuilderInterface.php
880 /modules/ps_accounts/vendor/ramsey/uuid/src/Codec/StringCodec.php
881 /modules/ps_accounts/vendor/ramsey/uuid/src/Codec/CodecInterface.php
882 /modules/ps_accounts/vendor/ramsey/uuid/src/Provider/Node/FallbackNodeProvider.php
883 /modules/ps_accounts/vendor/ramsey/uuid/src/Provider/NodeProviderInterface.php
884 /modules/ps_accounts/vendor/ramsey/uuid/src/Provider/Node/SystemNodeProvider.php
885 /modules/ps_accounts/vendor/ramsey/uuid/src/Provider/Node/RandomNodeProvider.php
886 /modules/ps_accounts/vendor/ramsey/uuid/src/Generator/RandomGeneratorFactory.php
887 /modules/ps_accounts/vendor/ramsey/uuid/src/Generator/RandomBytesGenerator.php
888 /modules/ps_accounts/vendor/ramsey/uuid/src/Generator/RandomGeneratorInterface.php
889 /modules/ps_accounts/vendor/ramsey/uuid/src/Provider/Time/SystemTimeProvider.php
890 /modules/ps_accounts/vendor/ramsey/uuid/src/Provider/TimeProviderInterface.php
891 /modules/ps_accounts/vendor/ramsey/uuid/src/Generator/TimeGeneratorFactory.php
892 /modules/ps_accounts/vendor/ramsey/uuid/src/Converter/Time/PhpTimeConverter.php
893 /modules/ps_accounts/vendor/ramsey/uuid/src/Converter/TimeConverterInterface.php
894 /modules/ps_accounts/vendor/ramsey/uuid/src/Generator/DefaultTimeGenerator.php
895 /modules/ps_accounts/vendor/ramsey/uuid/src/Generator/TimeGeneratorInterface.php
896 /modules/ps_accounts/vendor/ramsey/uuid/src/BinaryUtils.php
897 /modules/ps_accounts/src/Service/OAuth2/CachedFile.php
898 /modules/ps_accounts/src/Account/Session/Firebase/ShopSession.php
899 /modules/ps_accounts/src/Account/Session/Firebase/FirebaseSession.php
900 /modules/ps_accounts/src/Account/Session/Firebase/OwnerSession.php
901 /modules/ps_accounts/src/Account/StatusManager.php
902 /modules/ps_accounts/src/Traits/WithOriginAndSourceTrait.php
903 /modules/ps_accounts/src/Traits/WithPropertyTrait.php
904 /modules/ps_accounts/src/Service/Accounts/AccountsService.php
905 /modules/ps_accounts/src/Service/AnalyticsService.php
906 /modules/ps_accounts/src/Service/AdminTokenService.php
907 /modules/ps_accounts/src/Adapter/ConfigurationKeys.php
908 /modules/ps_accounts/src/Account/CachedShopStatus.php
909 /modules/ps_accounts/src/Http/Resource/Resource.php
910 /modules/ps_accounts/src/Type/Dto.php
911 /modules/ps_accounts/src/Service/Accounts/Resource/ShopStatus.php
912 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/ErrorHandler.php
913 /modules/ps_facebook/classes/Dispatcher/EventDispatcher.php
914 /modules/ps_facebook/classes/Handler/ApiConversionHandler.php
915 /modules/ps_facebook/classes/Adapter/ConfigurationAdapter.php
916 /modules/ps_facebook/classes/Factory/ContextFactory.php
917 /modules/ps_facebook/classes/API/Client/FacebookClient.php
918 /modules/ps_facebook/classes/Factory/FacebookEssentialsApiClientFactory.php
919 /modules/ps_facebook/classes/Factory/ApiClientFactoryInterface.php
920 /modules/ps_facebook/classes/Provider/AccessTokenProvider.php
921 /modules/ps_facebook/classes/Factory/PsApiClientFactory.php
922 /modules/ps_facebook/classes/Handler/ConfigurationHandler.php
923 /modules/ps_facebook/classes/Http/HttpClient.php
924 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Api.php
925 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Session.php
926 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/SessionInterface.php
927 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/ApiConfig.php
928 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/Client.php
929 /modules/ps_facebook/classes/Handler/PixelHandler.php
930 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/MockFileSessionStorage.php
931 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/MockArraySessionStorage.php
932 /modules/ps_facebook/classes/Provider/EventDataProvider.php
933 /modules/ps_facebook/classes/Adapter/ToolsAdapter.php
934 /modules/ps_facebook/classes/Repository/ProductRepository.php
935 /modules/ps_facebook/classes/Provider/ProductAvailabilityProvider.php
936 /modules/ps_facebook/classes/Provider/ProductAvailabilityProviderInterface.php
937 /modules/ps_facebook/classes/Repository/GoogleCategoryRepository.php
938 /modules/ps_facebook/classes/Provider/GoogleCategoryProvider.php
939 /modules/ps_facebook/classes/Provider/GoogleCategoryProviderInterface.php
940 /classes/Combination.php
941 /classes/stock/StockAvailable.php
942 /classes/tax/Tax.php
943 /vendor/prestashop/decimal/src/DecimalNumber.php
944 /vendor/prestashop/decimal/src/Builder.php
945 /classes/SpecificPrice.php
946 /classes/tax/TaxManagerFactory.php
947 /classes/tax/TaxRulesTaxManager.php
948 /classes/tax/TaxManagerInterface.php
949 /classes/tax/TaxCalculator.php
950 /classes/GroupReduction.php
951 /src/Core/Localization/CLDR/ComputingPrecision.php
952 /src/Core/Localization/CLDR/ComputingPrecisionInterface.php
953 /classes/Pack.php
954 /classes/order/Order.php
955 /classes/Feature.php
956 /src/Core/Domain/Combination/CombinationSettings.php
957 /modules/ps_facebook/classes/Utility/ProductCatalogUtility.php
958 /src/Core/Util/String/StringModifier.php
959 /src/Core/Util/String/StringModifierInterface.php
960 /modules/ps_facebook/classes/Utility/CustomerInformationUtility.php
961 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/ServerSide/UserData.php
962 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/ServerSide/CustomData.php
963 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/ServerSide/Event.php
964 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/ServerSide/ActionSource.php
965 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Enum/AbstractEnum.php
966 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Enum/EnumInstanceInterface.php
967 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/ServerSide/EventRequest.php
968 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/ServerSide/HttpServiceClientConfig.php
969 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/ServerSide/Singleton.php
970 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/ServerSide/Util.php
971 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/ServerSide/Normalizer.php
972 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/AdsPixel.php
973 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/AbstractCrudObject.php
974 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/AbstractObject.php
975 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/Fields/AdsPixelFields.php
976 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/TypeChecker.php
977 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/Values/AdsPixelSortByValues.php
978 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/Values/AdsPixelAutomaticMatchingFieldsValues.php
979 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/Values/AdsPixelDataUseSettingValues.php
980 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/Values/AdsPixelFirstPartyCookieStatusValues.php
981 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/Values/AdsPixelPermittedTasksValues.php
982 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/Values/AdsPixelTasksValues.php
983 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/ApiRequest.php
984 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/RequestInterface.php
985 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Enum/EmptyEnum.php
986 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/Request.php
987 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/Parameters.php
988 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Logger/NullLogger.php
989 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Logger/LoggerInterface.php
990 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/Adapter/CurlAdapter.php
991 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/Adapter/AbstractAdapter.php
992 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/Adapter/AdapterInterface.php
993 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/Adapter/Curl/AbstractCurl.php
994 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/Adapter/Curl/CurlInterface.php
995 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/Adapter/Curl/Curl55.php
996 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/Response.php
997 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/ResponseInterface.php
998 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/Headers.php
999 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/ServerSide/EventResponse.php
1000 /vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php
1001 /var/cache/prod/smarty/compile/warehouse/7b/d6/67/7bd6674da24c9dfe787a4ab6d9f95992772bfd39_2.file.header.tpl.php
1002 /vendor/smarty/smarty/libs/plugins/modifier.escape.php
1003 /var/cache/prod/smarty/compile/warehouse/e4/c2/28/e4c22868c11d8c62c1db61f765dd994d1dfa43b9_2.file.fbTrack.tpl.php
1004 /modules/psxmarketingwithgoogle/psxmarketingwithgoogle.php
1005 /modules/psxmarketingwithgoogle/translations/es.php
1006 /var/cache/prod/PsxmarketingwithgoogleFrontContainer.php
1007 /modules/psxmarketingwithgoogle/classes/Adapter/ConfigurationAdapter.php
1008 /modules/psxmarketingwithgoogle/classes/Factory/ContextFactory.php
1009 /modules/psxmarketingwithgoogle/classes/config/Config.php
1010 /modules/psxmarketingwithgoogle/classes/Handler/RemarketingHookHandler.php
1011 /modules/psxmarketingwithgoogle/classes/Buffer/TemplateBuffer.php
1012 /modules/iqitcookielaw/iqitcookielaw.php
1013 /modules/iqitcookielaw/translations/es.php
1014 /modules/iqitmegamenu/iqitmegamenu.php
1015 /modules/iqitmegamenu/models/IqitMenuTab.php
1016 /modules/iqitmegamenu/models/IqitMenuHtml.php
1017 /modules/iqitmegamenu/models/IqitMenuLinks.php
1018 /modules/iqitmegamenu/translations/es.php
1019 /modules/iqitelementor/iqitelementor.php
1020 /modules/iqitelementor/src/IqitElementorLanding.php
1021 /modules/iqitelementor/src/IqitElementorTemplate.php
1022 /modules/iqitelementor/src/IqitElementorProduct.php
1023 /modules/iqitelementor/src/IqitElementorCategory.php
1024 /modules/iqitelementor/src/IqitElementorContent.php
1025 /modules/iqitelementor/src/iqitElementorWpHelper.php
1026 /modules/iqitelementor/includes/plugin-elementor.php
1027 /modules/iqitelementor/src/widgets/IqitElementorWidget_Brands.php
1028 /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsList.php
1029 /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsListTabs.php
1030 /modules/iqitelementor/src/widgets/IqitElementorWidget_Modules.php
1031 /modules/iqitelementor/src/widgets/IqitElementorWidget_CustomTpl.php
1032 /modules/iqitelementor/src/widgets/IqitElementorWidget_Menu.php
1033 /modules/iqitelementor/src/widgets/IqitElementorWidget_RevolutionSlider.php
1034 /modules/iqitelementor/src/widgets/IqitElementorWidget_Newsletter.php
1035 /modules/iqitelementor/src/widgets/IqitElementorWidget_Blog.php
1036 /modules/iqitelementor/src/widgets/IqitElementorWidget_Search.php
1037 /modules/iqitelementor/src/widgets/IqitElementorWidget_Links.php
1038 /modules/iqitelementor/src/widgets/IqitElementorWidget_ContactForm.php
1039 /modules/iqitelementor/translations/es.php
1040 /modules/nacex/nacex.php
1041 /modules/nacex/nacexWS.php
1042 /modules/nacex/nacexDTO.php
1043 /modules/nacex/AdminConfig.php
1044 /modules/nacex/UserGuide.php
1045 /modules/nacex/VInewServices.php
1046 /modules/nacex/nacexutils.php
1047 /modules/nacex/LBnewService.php
1048 /modules/nacex/nacexDAO.php
1049 /modules/nacex/ROnacexshop.php
1050 /modules/nacex/tratardatos.php
1051 /modules/nacex/nacexVIEW.php
1052 /modules/nacex/hash.php
1053 /classes/module/CarrierModule.php
1054 /modules/nacex/translations/es.php
1055 /src/Core/Product/Search/ProductSearchContext.php
1056 /src/Core/Product/Search/ProductSearchQuery.php
1057 /src/Core/Product/Search/SortOrder.php
1058 /modules/ps_facetedsearch/ps_facetedsearch.php
1059 /modules/ps_facetedsearch/src/HookDispatcher.php
1060 /modules/ps_facetedsearch/src/Hook/Attribute.php
1061 /modules/ps_facetedsearch/src/Hook/AbstractHook.php
1062 /modules/ps_facetedsearch/src/Hook/AttributeGroup.php
1063 /modules/ps_facetedsearch/src/Hook/Category.php
1064 /modules/ps_facetedsearch/src/Hook/Configuration.php
1065 /modules/ps_facetedsearch/src/Hook/Design.php
1066 /modules/ps_facetedsearch/src/Hook/Feature.php
1067 /modules/ps_facetedsearch/src/Form/Feature/FormModifier.php
1068 /modules/ps_facetedsearch/src/Form/Feature/FormDataProvider.php
1069 /modules/ps_facetedsearch/src/Hook/FeatureValue.php
1070 /modules/ps_facetedsearch/src/Form/FeatureValue/FormModifier.php
1071 /modules/ps_facetedsearch/src/Form/FeatureValue/FormDataProvider.php
1072 /modules/ps_facetedsearch/src/Hook/Product.php
1073 /modules/ps_facetedsearch/src/Hook/ProductSearch.php
1074 /modules/ps_facetedsearch/src/Hook/SpecificPrice.php
1075 /modules/ps_facetedsearch/src/Filters/Provider.php
1076 /modules/ps_facetedsearch/src/URLSerializer.php
1077 /modules/ps_facetedsearch/src/Filters/DataAccessor.php
1078 /modules/ps_facetedsearch/src/Product/SearchProvider.php
1079 /src/Core/Product/Search/FacetsRendererInterface.php
1080 /src/Core/Product/Search/ProductSearchProviderInterface.php
1081 /modules/ps_facetedsearch/src/Filters/Converter.php
1082 /modules/ps_facetedsearch/src/Product/SearchFactory.php
1083 /src/Core/Product/Search/ProductSearchResult.php
1084 /modules/ps_facetedsearch/src/Product/Search.php
1085 /modules/ps_facetedsearch/src/Adapter/MySQL.php
1086 /modules/ps_facetedsearch/src/Adapter/AbstractAdapter.php
1087 /modules/ps_facetedsearch/src/Adapter/InterfaceAdapter.php
1088 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ArrayCollection.php
1089 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Collection.php
1090 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ReadableCollection.php
1091 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Selectable.php
1092 /modules/ps_facetedsearch/src/Filters/Products.php
1093 /modules/ps_facetedsearch/src/Filters/Block.php
1094 /src/Core/Product/Search/Facet.php
1095 /src/Core/Product/Search/Filter.php
1096 /src/Core/Product/Search/FacetCollection.php
1097 /classes/ProductAssembler.php
1098 /classes/Manufacturer.php
1099 /classes/ProductPresenterFactory.php
1100 /src/Adapter/Presenter/Product/ProductListingPresenter.php
1101 /src/Adapter/Presenter/Product/ProductPresenter.php
1102 /src/Adapter/Product/ProductColorsRetriever.php
1103 /src/Core/Product/ProductPresentationSettings.php
1104 /src/Adapter/Presenter/Product/ProductListingLazyArray.php
1105 /src/Adapter/Presenter/Product/ProductLazyArray.php
1106 /classes/Image.php
1107 /var/cache/prod/smarty/compile/warehouse/d4/1d/65/d41d65d76b9471b5d365fe06cf1737c89a53af9f_2.module.ps_facetedsearchviewstemplatesfrontcatalogfacets.tpl.php
1108 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_block.php
1109 /vendor/smarty/smarty/libs/plugins/modifier.count.php
1110 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php
1111 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_foreach.php
1112 /var/cache/prod/smarty/compile/warehouse/2e/80/73/2e807335546cfa2360c36327ac89dd2fcb054379_2.module.ps_facetedsearchviewstemplatesfrontcatalogactivefilters.tpl.php
1113 /src/Core/Product/Search/Pagination.php
1114 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/75/a6/42/75a64202e97931196bc7ffc62f78ffd65260f53c_2.file.category.tpl.php
1115 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_capture.php
1116 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/94/12/cc/9412ccef9680927153b45c6ae144d544996206b6_2.file.product-list.tpl.php
1117 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/b9/42/2f/b9422fde64d87165f5f5c624a4cbefbe5f5cc591_2.file.layout-left-column.tpl.php
1118 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/d2/95/d8/d295d85097e23dfc619a6d9948f9bb0871953825_2.file.layout-both-columns.tpl.php
1119 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/48/f1/3f/48f13f505ce53fe1a91e5a59ff252495434ac43d_2.file.helpers.tpl.php
1120 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_tplfunction.php
1121 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/1b/22/bc/1b22bcae0a59cc6b48cc1c9c25235f501651e518_2.file.head.tpl.php
1122 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/41/92/2e/41922ed228227013af99527db113ad08c91d4c9b_2.file.head-jsonld.tpl.php
1123 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/e2/41/5c/e2415c4af2ebd285942a955984af4b4e1aa22189_2.file.product-list-jsonld.tpl.php
1124 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/04/1b/47/041b4759bcd23a9de0adfa67f3a43b8b64636a07_2.file.pagination-seo.tpl.php
1125 /vendor/smarty/smarty/libs/plugins/modifier.replace.php
1126 /vendor/smarty/smarty/libs/plugins/shared.mb_str_replace.php
1127 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/43/32/e4/4332e4a9374e52ec03407d255e0717700fe0ae38_2.file.stylesheets.tpl.php
1128 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/ad/11/eb/ad11ebbbe1d132c2eb222c363cd04b3dee98d8fb_2.file.javascript.tpl.php
1129 /classes/ProductDownload.php
1130 /src/Core/Cart/Calculator.php
1131 /src/Core/Cart/CartRowCollection.php
1132 /src/Core/Cart/Fees.php
1133 /src/Core/Cart/AmountImmutable.php
1134 /src/Core/Cart/CartRuleCollection.php
1135 /src/Core/Cart/CartRuleCalculator.php
1136 /src/Adapter/Product/PriceCalculator.php
1137 /src/Core/Cart/CartRow.php
1138 /vendor/symfony/symfony/src/Symfony/Component/Translation/PluralizationRules.php
1139 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/b3/9c/46/b39c46fe99acdbe1574e9b876a398a0024152c16_2.file.product-activation.tpl.php
1140 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/da/79/cf/da79cf6aab6675d177369043b59a83d42869b4f0_2.file.header.tpl.php
1141 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/6a/a2/df/6aa2dfd27b196571f30e719112e04b70f089f033_2.file.social-links.tpl.php
1142 /modules/iqitlinksmanager/iqitlinksmanager.php
1143 /modules/iqitlinksmanager/src/IqitLinkBlockRepository.php
1144 /modules/iqitlinksmanager/src/IqitLinkBlock.php
1145 /modules/iqitlinksmanager/src/IqitLinkBlockPresenter.php
1146 /modules/iqitlinksmanager/translations/es.php
1147 /vendor/smarty/smarty/libs/sysplugins/smarty_template_cached.php
1148 /vendor/smarty/smarty/libs/sysplugins/smarty_cacheresource.php
1149 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_cacheresource_file.php
1150 /var/cache/prod/smarty/cache/iqitlinksmanager/1/1/1/6/displayNav1/warehouse/00/9f/22/009f22a54fda4ac75973e63c46f0132b1119ba03.iqitlinksmanagerviewstemplateshookiqitlinksmanager.tpl.php
1151 /modules/ps_languageselector/ps_languageselector.php
1152 /modules/ps_currencyselector/ps_currencyselector.php
1153 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/08/d5/04/08d504d7a022befca93803f3e17505b861ca8248_2.file.header-3.tpl.php
1154 /modules/iqitsearch/iqitsearch.php
1155 /modules/iqitsearch/translations/es.php
1156 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_gettemplatevars.php
1157 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/d9/9b/94/d99b947421dcff226f28b1d6cb674c91f17399db_2.module.iqitsearchviewstemplateshookiqitsearchbtn.tpl.php
1158 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/46/29/db/4629dbb3c4efa13c090c633dc2e46e5f2b42bed3_2.module.iqitsearchviewstemplateshooksearchbar.tpl.php
1159 /modules/ps_customersignin/ps_customersignin.php
1160 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/72/be/19/72be192e406191c1cad554abe284e159adeb4234_2.module.ps_customersigninps_customersigninbtn.tpl.php
1161 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/b4/a4/76/b4a476e0a8201677b298f7c0f8ca1ac698e1bac3_2.module.ps_shoppingcartps_shoppingcartbtn.tpl.php
1162 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/35/65/5e/35655e6409b6198f29dd6e732ef9598dec599880_2.module.ps_shoppingcartps_shoppingcart.tpl.php
1163 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/f6/e9/f2/f6e9f2b1680a466582d2199d038efe2cfa3a83f7_2.module.ps_shoppingcartps_shoppingcartcontent.tpl.php
1164 /var/cache/prod/smarty/cache/iqitmegamenu/index/1/1/1/6/warehouse/0e/3d/e6/0e3de6994bee6e3198146e208ce6beab444c9b4c.iqitmegamenuviewstemplateshookhorizontal.tpl.php
1165 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/cc/19/65/cc196527306127f5e0d92c634bf0405f2119a661_2.file.mobile-header-2.tpl.php
1166 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/7a/30/38/7a3038780284d52e9fcd7a66e51e5b86a166106b_2.module.iqitsearchviewstemplateshooksearchbarmobile.tpl.php
1167 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/be/ee/e6/beeee6f3d87613010f8af1cabc4c4562f8cf600a_2.module.ps_customersigninps_customersigninmobile.tpl.php
1168 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/d4/e1/57/d4e1571b6b210795247564db06deb17061778b51_2.module.ps_shoppingcartps_shoppingcartmqty.tpl.php
1169 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/90/d8/0a/90d80a9022c08011c7d753c6c3e409a4ae5b7fda_2.file.breadcrumb.tpl.php
1170 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/19/19/82/191982fa1e9d343688d9b381fea21c314a7ebef3_2.file.notifications.tpl.php
1171 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/3f/08/79/3f087969496cb1217bbe01ca6f95bbcaae18b1cf_2.file.category-header.tpl.php
1172 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/3e/fc/5c/3efc5c6cabf68a518dde9956926db6cf60a93dd5_2.file.products-top.tpl.php
1173 /vendor/smarty/smarty/libs/plugins/modifier.regex_replace.php
1174 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/5e/be/46/5ebe46ba384c4e31c6497e544847aec50e2df7ed_2.file.sort-orders.tpl.php
1175 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/df/95/52/df9552fec00c67a219e4d30c27efc6f3e649e435_2.file.products.tpl.php
1176 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/55/7a/be/557abe380aacf1dcc82a9614401a41c90059c373_2.file.product.tpl.php
1177 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/83/21/1d/83211d3e18c7848aecc64c18474f33bc0ea7cd65_2.file.product-miniature-1.tpl.php
1178 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/0a/d6/ba/0ad6ba9370f144df31a3308c307c61383af0f46f_2.file.product-miniature-thumb.tpl.php
1179 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/54/f1/31/54f131cbfede74c5ff970f4d07b4366036e2f8db_2.file.product-miniature-btn.tpl.php
1180 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/c2/18/5e/c2185e235e559bf004db69cd2c6a7703df41adb0_2.file.pagination.tpl.php
1181 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/5e/fc/91/5efc91d7387e3670df18e3cf6645652c4546f7c9_2.file.products-bottom.tpl.php
1182 /var/cache/prod/smarty/compile/warehouse/81/a1/04/81a1040ed0eeab6f58198f9907167c7fced628c5_2.module.ps_facetedsearchps_facetedsearch.tpl.php
1183 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/36/7c/da/367cdad5e95c9d0937b2526e141cbe7cc11d72f9_2.file.footer.tpl.php
1184 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/2c/ca/be/2ccabe66f524058310a6818abce4e6d56ee1bb64_2.file.footer-1.tpl.php
1185 /var/cache/prod/smarty/cache/iqitlinksmanager/1/1/1/6/displayFooter/warehouse/00/9f/22/009f22a54fda4ac75973e63c46f0132b1119ba03.iqitlinksmanagerviewstemplateshookiqitlinksmanager.tpl.php
1186 /modules/corewhatsapp/corewhatsapp.php
1187 /modules/corewhatsapp/classes/Corewhatsapp.php
1188 /var/cache/prod/smarty/compile/warehouse/f3/d9/ed/f3d9ed074127cff4b22b15d975f7cd788fe3a35d_2.file.corewhatsapp.tpl.php
1189 /var/cache/prod/smarty/compile/warehouse/30/7d/c6/307dc6bd4724d29d1572cc301dd7148e962604ef_2.module.ps_emailsubscriptionviewstemplateshookps_emailsubscription.tpl.php
1190 /modules/psgdpr/psgdpr.php
1191 /modules/psgdpr/translations/es.php
1192 /modules/psgdpr/classes/GDPRConsent.php
1193 /var/cache/prod/smarty/compile/warehouse/5e/ee/24/5eee242e5cbca9bb89b8ffa439cebef7beaaf2e4_2.module.psgdprviewstemplateshookdisplayGDPRConsent.tpl.php
1194 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/94/7d/69/947d69d2647da7c0eeb75ef9497030be726dc5dc_2.file.footer-copyrights-1.tpl.php
1195 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/ef/d8/5e/efd85eed67e0be9a97e7376c50dacb5344f76046_2.file.password-policy-template.tpl.php
1196 /var/cache/prod/smarty/cache/iqitcookielaw/1/1/1/6/warehouse/e7/7b/d0/e77bd029c1dc3735e3f4798f608cdf3e90a317c6.iqitcookielawviewstemplateshookiqitcookielaw.tpl.php
1197 /modules/statsdata/statsdata.php
1198 /classes/Connection.php
1199 /classes/ConnectionsSource.php