Inicio

Utilizamos cookies propias y de terceros para mejorar nuestros servicios y mostrarle publicidad

relacionada con sus preferencias mediante el análisis de sus hábitos de navegación. Puede

consultar nuestra Política de cookies  aquí

Load Time 777.926 ms
Querying Time 276 ms
Queries 806
Memory Peak Usage 25.6 Mb
Included Files 1201 files - 11.79 Mb
PrestaShop Cache - Mb
Global vars 0.25 Mb
PrestaShop Version 8.2.4
PHP Version 8.2.30
MySQL Version 10.3.39-MariaDB
Memory Limit 524M
Max Execution Time 120s
Smarty Cache enabled
Smarty Compilation never recompile
  Time Cumulated Time Memory Usage Memory Peak Usage
config 51.359 ms 51.359 ms 2.97 Mb 3.0 Mb
__construct 1.606 ms 52.965 ms - Mb 3.5 Mb
init 20.189 ms 73.154 ms 1.29 Mb 4.3 Mb
checkAccess 0.002 ms 73.156 ms - Mb 4.3 Mb
setMedia 2.336 ms 75.492 ms 0.12 Mb 4.4 Mb
postProcess 0.001 ms 75.493 ms - Mb 4.4 Mb
initHeader 0.002 ms 75.495 ms - Mb 4.4 Mb
initContent 623.354 ms 698.849 ms 15.70 Mb 20.2 Mb
initFooter 0.002 ms 698.851 ms - Mb 20.2 Mb
display 79.075 ms 777.926 ms 4.78 Mb 25.6 Mb
Hook Time Memory Usage
DisplayHeader 409.381 ms 4.77 Mb
DisplayBeforeBodyClosingTag 20.527 ms 0.30 Mb
displayFooter 6.521 ms 0.41 Mb
displayNav1 1.794 ms 0.14 Mb
ProductSearchProvider 1.698 ms 0.18 Mb
DisplayGDPRConsent 1.170 ms 0.11 Mb
DisplayFooter 1.140 ms 0.06 Mb
displayMainMenu 0.904 ms 0.17 Mb
displayBeforeBodyClosingTag 0.792 ms 0.05 Mb
displayNav2 0.513 ms 0.08 Mb
DisplayLeftColumn 0.447 ms 0.11 Mb
ActionFrontControllerSetMedia 0.382 ms 0.01 Mb
IsJustElementor 0.242 ms 0.02 Mb
displayVerticalMenu 0.011 ms - Mb
ActionDispatcher 0.009 ms - Mb
ActionProductSearchAfter 0.005 ms - Mb
Header 0.004 ms - Mb
17 hook(s) 445.540 ms 6.41 Mb
Module Time Memory Usage
iqitthemeeditor 1.318 ms 0.12 Mb
ps_emailsubscription 6.544 ms 0.42 Mb
ps_facebook 406.838 ms 4.59 Mb
ps_emailalerts 0.200 ms 0.04 Mb
productcomments 0.310 ms 0.03 Mb
ps_shoppingcart 0.128 ms 0.02 Mb
ps_accounts 1.174 ms 0.03 Mb
psxmarketingwithgoogle 2.279 ms 0.17 Mb
iqitcookielaw 1.845 ms 0.12 Mb
iqitmegamenu 6.143 ms 1.01 Mb
iqitelementor 6.695 ms 1.02 Mb
nacex 12.438 ms 2.03 Mb
ps_facetedsearch 5.627 ms 0.79 Mb
iqitlinksmanager 3.556 ms 0.30 Mb
ps_languageselector 0.498 ms 0.07 Mb
ps_currencyselector 0.533 ms 0.07 Mb
iqitsearch 0.570 ms 0.04 Mb
ps_customersignin 0.224 ms 0.04 Mb
corewhatsapp 1.653 ms 0.12 Mb
psgdpr 2.960 ms 0.32 Mb
statsdata 20.601 ms 0.32 Mb
21 module(s) 482.135 ms 11.67 Mb

Stopwatch SQL - 806 queries

# Query Time (ms) Rows Filesort Group By Location
79 
SELECT SQL_NO_CACHE p.*, product_shop.*, stock.out_of_stock, IFNULL(stock.quantity, 0) AS quantity, IFNULL(product_attribute_shop.id_product_attribute, 0) AS id_product_attribute,
product_attribute_shop.minimal_quantity AS product_attribute_minimal_quantity, pl.`description`, pl.`description_short`, pl.`available_now`,
pl.`available_later`, pl.`link_rewrite`, pl.`meta_description`, pl.`meta_keywords`, pl.`meta_title`, pl.`name`, image_shop.`id_image` id_image,
il.`legend` as legend, m.`name` AS manufacturer_name, cl.`name` AS category_default,
DATEDIFF(product_shop.`date_add`, DATE_SUB("2026-04-13 00:00:00",
INTERVAL 30 DAY)) > 0 AS new, product_shop.price AS orderprice
FROM `prstshp_category_product` cp
LEFT JOIN `prstshp_product` p
ON p.`id_product` = cp.`id_product`
INNER JOIN prstshp_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1) LEFT JOIN `prstshp_product_attribute_shop` product_attribute_shop
ON (p.`id_product` = product_attribute_shop.`id_product` AND product_attribute_shop.`default_on` = 1 AND product_attribute_shop.id_shop=1)
LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `p`.id_product AND stock.id_product_attribute = 0 AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `prstshp_category_lang` cl
ON (product_shop.`id_category_default` = cl.`id_category`
AND cl.`id_lang` = 2 AND cl.id_shop = 1 )
LEFT JOIN `prstshp_product_lang` pl
ON (p.`id_product` = pl.`id_product`
AND pl.`id_lang` = 2 AND pl.id_shop = 1 )
LEFT JOIN `prstshp_image_shop` image_shop
ON (image_shop.`id_product` = p.`id_product` AND image_shop.cover=1 AND image_shop.id_shop=1)
LEFT JOIN `prstshp_image_lang` il
ON (image_shop.`id_image` = il.`id_image`
AND il.`id_lang` = 2)
LEFT JOIN `prstshp_manufacturer` m
ON m.`id_manufacturer` = p.`id_manufacturer`
WHERE product_shop.`id_shop` = 1
AND cp.`id_category` = 2 AND product_shop.`active` = 1 AND product_shop.`visibility` IN ("both", "catalog") ORDER BY cp.`position` ASC
LIMIT 768,24
 49.640 ms 5250 Yes /classes/Category.php:1062
387 
SELECT SQL_NO_CACHE p.id_product FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND cp.id_category IN (18, 124, 86) GROUP BY p.id_product) p GROUP BY p.id_product ORDER BY p.date_add DESC, p.id_product DESC
 26.035 ms 5745609 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
799 
INSERT INTO `prstshp_guest` (`id_operating_system`, `id_web_browser`, `id_customer`, `javascript`, `screen_resolution_x`, `screen_resolution_y`, `screen_color`, `sun_java`, `adobe_flash`, `adobe_director`, `apple_quicktime`, `real_player`, `windows_media`, `accept_language`, `mobile_theme`) VALUES ('0', '0', '0', '0', '0', '0', '0', '0', '0', '0', '0', '0', '0', '', '0')
 12.707 ms 1 /classes/ObjectModel.php:622
592 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1512 AND id_shop=1 LIMIT 1
 5.891 ms 1 /classes/Product.php:6884
640 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1477 AND id_shop=1 LIMIT 1
 5.546 ms 1 /classes/Product.php:6884
651 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1476)
 2.825 ms 1 /classes/Product.php:3860
2 
SELECT SQL_NO_CACHE c.`name`, cl.`id_lang`, IF(cl.`id_lang` IS NULL, c.`value`, cl.`value`) AS value, c.id_shop_group, c.id_shop
FROM `prstshp_configuration` c
LEFT JOIN `prstshp_configuration_lang` cl ON (c.`id_configuration` = cl.`id_configuration`)
 2.720 ms 1360 /classes/Configuration.php:180
803 
INSERT INTO `prstshp_connections` (`id_guest`, `id_page`, `ip_address`, `http_referer`, `id_shop`, `id_shop_group`, `date_add`) VALUES ('16684218', '118', '3628718218', '', '1', '1', '2026-04-13 11:48:44')
 2.586 ms 1 /classes/ObjectModel.php:622
793 
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module` WHERE `name` = "ps_emailsubscription" LIMIT 1
 2.356 ms 1 /classes/module/Module.php:2664
756 
SELECT SQL_NO_CACHE 1 FROM `prstshp_cart_rule` WHERE ((date_to >= "2026-04-13 00:00:00" AND date_to <= "2026-04-13 23:59:59") OR (date_from >= "2026-04-13 00:00:00" AND date_from <= "2026-04-13 23:59:59") OR (date_from < "2026-04-13 00:00:00" AND date_to > "2026-04-13 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
 2.055 ms 7 /classes/CartRule.php:357
642 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1477) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 2.039 ms 1 /classes/stock/StockAvailable.php:453
93 
SELECT SQL_NO_CACHE `id_hook`, `name`
FROM `prstshp_hook`
UNION
SELECT `id_hook`, ha.`alias` as name
FROM `prstshp_hook_alias` ha
INNER JOIN `prstshp_hook` h ON ha.name = h.name
 1.653 ms 0 /classes/Hook.php:1348
673 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1472
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 1.471 ms 1 /classes/SpecificPrice.php:256
652 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1476 AND id_shop=1 LIMIT 1
 1.403 ms 1 /classes/Product.php:6884
456 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1627
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 1.318 ms 0 /classes/SpecificPrice.php:256
458 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1627)
 1.216 ms 1 /classes/Product.php:3860
684 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 1664
ORDER BY `position`
 1.155 ms 3 Yes /classes/Product.php:3539
13 
SELECT SQL_NO_CACHE h.`name` as hook, m.`id_module`, h.`id_hook`, m.`name` as module
FROM `prstshp_module` m
INNER JOIN prstshp_module_shop module_shop
ON (module_shop.id_module = m.id_module AND module_shop.id_shop = 1 AND module_shop.enable_device & 1)
INNER JOIN `prstshp_hook_module` `hm` ON hm.`id_module` = m.`id_module`
INNER JOIN `prstshp_hook` `h` ON hm.`id_hook` = h.`id_hook`
LEFT JOIN `prstshp_module_group` `mg` ON mg.`id_module` = m.`id_module`
WHERE (h.`name` != "paymentOptions") AND (hm.`id_shop` = 1) AND (mg.id_shop = 1 AND  mg.`id_group` IN (1))
GROUP BY hm.id_hook, hm.id_module
ORDER BY hm.`position`
 1.098 ms 114 Yes Yes /classes/Hook.php:1289
804 
INSERT INTO `prstshp_connections_source` (`id_connections`, `http_referer`, `request_uri`, `keywords`, `date_add`) VALUES ('15469703', '', 'www.joieriaorfi.es/2-inicio?page=33&q=Categor%C3%ADas-JOYAS+DE+PLATA-ORO+14K-COMUNI%C3%93N', '', '2026-04-13 11:48:44')
 1.097 ms 1 /classes/ObjectModel.php:622
94 
SELECT SQL_NO_CACHE h.id_hook, h.name as h_name, title, description, h.position, hm.position as hm_position, m.id_module, m.name, m.active
FROM `prstshp_hook_module` hm
STRAIGHT_JOIN `prstshp_hook` h ON (h.id_hook = hm.id_hook AND hm.id_shop = 1)
STRAIGHT_JOIN `prstshp_module` as m ON (m.id_module = hm.id_module)
ORDER BY hm.position
 1.063 ms 516 /classes/Hook.php:455
389 
SELECT SQL_NO_CACHE p.*,
ps.*,
pl.*,
sa.out_of_stock,
IFNULL(sa.quantity, 0) as quantity,
(DATEDIFF(
p.`date_add`,
DATE_SUB(
'2026-04-13 00:00:00',
INTERVAL 30 DAY
)
) > 0) as new
FROM prstshp_product p
LEFT JOIN prstshp_product_lang pl
ON pl.id_product = p.id_product
AND pl.id_shop = 1
AND pl.id_lang = 2
LEFT JOIN prstshp_stock_available sa   ON sa.id_product = p.id_product
AND sa.id_product_attribute = 0
AND sa.id_shop = 1 LEFT JOIN prstshp_product_shop ps
ON ps.id_product = p.id_product
AND ps.id_shop = 1
WHERE p.id_product IN (1672,1664,1663,1661,1660,1627,1625,1623,1618,1615,1593,1591,1588,1584,1579,1574,1512,1492,1487,1485,1477,1476,1473,1472)
 0.996 ms 24 /classes/ProductAssembler.php:95
644 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1477
ORDER BY f.position ASC
 0.775 ms 1 Yes /classes/Product.php:6024
590 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1512 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.769 ms 1 Yes /classes/SpecificPrice.php:576
39 
SELECT SQL_NO_CACHE c.*, cl.`id_lang`, cl.`name`, cl.`description`, cl.`additional_description`, cl.`link_rewrite`, cl.`meta_title`, cl.`meta_keywords`, cl.`meta_description`
FROM `prstshp_category` c
INNER JOIN prstshp_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `prstshp_category_lang` cl ON (c.`id_category` = cl.`id_category` AND `id_lang` = 2  AND cl.id_shop = 1 )
LEFT JOIN `prstshp_category_group` cg ON (cg.`id_category` = c.`id_category`)
WHERE `id_parent` = 2
AND `active` = 1
AND cg.`id_group` =1
GROUP BY c.`id_category`
ORDER BY `level_depth` ASC, category_shop.`position` ASC
 0.766 ms 25 Yes Yes /classes/Category.php:916
12 
SELECT SQL_NO_CACHE lower(name) as name
FROM `prstshp_hook` h
WHERE (h.active = 1)
 0.752 ms 1097 /classes/Hook.php:1388
801 
SELECT SQL_NO_CACHE id_page_type
FROM prstshp_page_type
WHERE name = 'category' LIMIT 1
 0.749 ms 1 /classes/Page.php:100
641 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1477 AND `id_group` = 1 LIMIT 1
 0.695 ms 0 /classes/GroupReduction.php:153
643 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1477 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1477 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.673 ms 0 /classes/Cart.php:1430
662 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1473 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.639 ms 1 Yes /classes/SpecificPrice.php:576
632 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1485
ORDER BY f.position ASC
 0.622 ms 1 Yes /classes/Product.php:6024
754 
SELECT SQL_NO_CACHE 1 FROM prstshp_cart_product cp INNER JOIN prstshp_product p
ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps
ON (ps.id_shop = cp.id_shop AND ps.id_product = p.id_product) WHERE cp.id_cart=0 LIMIT 1
 0.610 ms 1 /classes/Cart.php:4250
16 
SELECT SQL_NO_CACHE `id_hook`, `name` FROM `prstshp_hook`
 0.601 ms 1097 /classes/Hook.php:1348
388 
SELECT SQL_NO_CACHE data FROM prstshp_layered_filter_block WHERE hash="3e8b134cfcd46289dfbd458a560e69b1" LIMIT 1
 0.573 ms 1 /modules/ps_facetedsearch/src/Filters/Block.php:185
655 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1476 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1476 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.556 ms 0 /classes/Cart.php:1430
420 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1663 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.530 ms 1 Yes /classes/SpecificPrice.php:576
767 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1672) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
 0.524 ms 1 Yes /classes/Product.php:4513
626 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1485 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.518 ms 1 Yes /classes/SpecificPrice.php:576
618 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1487) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.487 ms 1 /classes/stock/StockAvailable.php:453
638 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1477 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.477 ms 1 Yes /classes/SpecificPrice.php:576
685 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 1664
 0.474 ms 1 /classes/Product.php:2899
15 
SELECT SQL_NO_CACHE m.page, ml.url_rewrite, ml.id_lang
FROM `prstshp_meta` m
LEFT JOIN `prstshp_meta_lang` ml ON (m.id_meta = ml.id_meta AND ml.id_shop = 1 )
ORDER BY LENGTH(ml.url_rewrite) DESC
 0.473 ms 56 Yes /classes/Dispatcher.php:654
674 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1472 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.469 ms 1 Yes /classes/SpecificPrice.php:576
408 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1664 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.445 ms 1 Yes /classes/SpecificPrice.php:576
595 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1512 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1512 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.443 ms 0 /classes/Cart.php:1430
589 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1512
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.430 ms 1 /classes/SpecificPrice.php:256
373 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2347 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.423 ms 1 Yes /classes/SpecificPrice.php:576
614 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1487 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.423 ms 1 Yes /classes/SpecificPrice.php:576
619 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1487 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1487 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.420 ms 0 /classes/Cart.php:1430
602 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1492 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.419 ms 1 Yes /classes/SpecificPrice.php:576
45 
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 15) AND (b.`id_shop` = 1) LIMIT 1
 0.419 ms 1 /src/Adapter/EntityMapper.php:71
755 
SELECT SQL_NO_CACHE 1 FROM `prstshp_cart_rule` WHERE ((date_to >= "2026-04-13 00:00:00" AND date_to <= "2026-04-13 23:59:59") OR (date_from >= "2026-04-13 00:00:00" AND date_from <= "2026-04-13 23:59:59") OR (date_from < "2026-04-13 00:00:00" AND date_to > "2026-04-13 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
 0.415 ms 7 /classes/CartRule.php:357
0 
SELECT SQL_NO_CACHE s.id_shop, CONCAT(su.physical_uri, su.virtual_uri) AS uri, su.domain, su.main
FROM prstshp_shop_url su
LEFT JOIN prstshp_shop s ON (s.id_shop = su.id_shop)
WHERE (su.domain = 'www.joieriaorfi.es' OR su.domain_ssl = 'www.joieriaorfi.es')
AND s.active = 1
AND s.deleted = 0
ORDER BY LENGTH(CONCAT(su.physical_uri, su.virtual_uri)) DESC
 0.408 ms 1 Yes /classes/shop/Shop.php:1364
623 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1485) AND (b.`id_shop` = 1) LIMIT 1
 0.405 ms 1 /src/Adapter/EntityMapper.php:71
768 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1664) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
 0.401 ms 1 Yes /classes/Product.php:4513
631 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1485 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1485 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.396 ms 0 /classes/Cart.php:1430
769 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1663) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
 0.391 ms 1 Yes /classes/Product.php:4513
770 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1661) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
 0.391 ms 1 Yes /classes/Product.php:4513
667 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1473 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1473 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.390 ms 0 /classes/Cart.php:1430
620 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1487
ORDER BY f.position ASC
 0.388 ms 1 Yes /classes/Product.php:6024
301 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2324 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.387 ms 1 Yes /classes/SpecificPrice.php:576
650 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1476 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.385 ms 1 Yes /classes/SpecificPrice.php:576
679 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1472 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1472 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.384 ms 0 /classes/Cart.php:1430
110 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2285 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.380 ms 1 Yes /classes/SpecificPrice.php:576
784 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1492) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
 0.376 ms 1 Yes /classes/Product.php:4513
444 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1660 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.373 ms 1 Yes /classes/SpecificPrice.php:576
401 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1672 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1672 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.372 ms 0 /classes/Cart.php:1430
449 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1660 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1660 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.372 ms 0 /classes/Cart.php:1430
681 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 1672
ORDER BY `position`
 0.372 ms 3 Yes /classes/Product.php:3539
687 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 1663
ORDER BY `position`
 0.370 ms 3 Yes /classes/Product.php:3539
396 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1672 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.366 ms 1 Yes /classes/SpecificPrice.php:576
781 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1579) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
 0.366 ms 1 Yes /classes/Product.php:4513
90 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2284 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.365 ms 1 Yes /classes/SpecificPrice.php:576
680 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1472
ORDER BY f.position ASC
 0.365 ms 1 Yes /classes/Product.php:6024
383 
SELECT SQL_NO_CACHE type, id_value, filter_show_limit, filter_type FROM prstshp_layered_category
WHERE controller = 'category'
AND id_category = 2
AND id_shop = 1
GROUP BY `type`, id_value ORDER BY position ASC
 0.365 ms 2 Yes Yes /modules/ps_facetedsearch/src/Filters/Provider.php:57
596 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1512
ORDER BY f.position ASC
 0.364 ms 1 Yes /classes/Product.php:6024
777 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1593) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
 0.363 ms 1 Yes /classes/Product.php:4513
776 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1615) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
 0.362 ms 1 Yes /classes/Product.php:4513
778 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1591) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
 0.361 ms 1 Yes /classes/Product.php:4513
782 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1574) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
 0.361 ms 1 Yes /classes/Product.php:4513
493 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1618 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.360 ms 1 Yes /classes/SpecificPrice.php:576
780 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1584) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
 0.359 ms 1 Yes /classes/Product.php:4513
425 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1663 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1663 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.358 ms 0 /classes/Cart.php:1430
457 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1627 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.358 ms 1 Yes /classes/SpecificPrice.php:576
683 
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (1935) AND il.`id_lang` = 2 ORDER by i.`position`
 0.357 ms 1 Yes /classes/Product.php:2915
789 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1473) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
 0.351 ms 1 Yes /classes/Product.php:4513
75 
SELECT SQL_NO_CACHE value FROM `prstshp_configuration` WHERE `name` = "PS_MULTISHOP_FEATURE_ACTIVE" LIMIT 1
 0.350 ms 1 /modules/ps_accounts/src/Adapter/Configuration.php:278
772 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1627) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
 0.350 ms 1 Yes /classes/Product.php:4513
779 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1588) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
 0.349 ms 1 Yes /classes/Product.php:4513
206 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2303 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.348 ms 1 Yes /classes/SpecificPrice.php:576
413 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1664 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1664 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.348 ms 0 /classes/Cart.php:1430
582 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1574 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1574 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.347 ms 0 /classes/Cart.php:1430
787 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1477) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
 0.347 ms 1 Yes /classes/Product.php:4513
788 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1476) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
 0.347 ms 1 Yes /classes/Product.php:4513
102 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2284 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2284 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.346 ms 0 /classes/Cart.php:1430
432 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1661 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.345 ms 1 Yes /classes/SpecificPrice.php:576
785 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1487) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
 0.345 ms 1 Yes /classes/Product.php:4513
771 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1660) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
 0.344 ms 1 Yes /classes/Product.php:4513
437 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1661 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1661 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.343 ms 0 /classes/Cart.php:1430
587 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1512) AND (b.`id_shop` = 1) LIMIT 1
 0.341 ms 1 /src/Adapter/EntityMapper.php:71
659 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1473) AND (b.`id_shop` = 1) LIMIT 1
 0.340 ms 1 /src/Adapter/EntityMapper.php:71
775 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1618) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
 0.340 ms 1 Yes /classes/Product.php:4513
786 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1485) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
 0.340 ms 1 Yes /classes/Product.php:4513
199 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2301 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2301 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.338 ms 0 /classes/Cart.php:1430
783 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1512) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
 0.337 ms 1 Yes /classes/Product.php:4513
134 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2287 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.334 ms 1 Yes /classes/SpecificPrice.php:576
158 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2296 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.334 ms 1 Yes /classes/SpecificPrice.php:576
656 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1476
ORDER BY f.position ASC
 0.333 ms 1 Yes /classes/Product.php:6024
773 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1625) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
 0.333 ms 1 Yes /classes/Product.php:4513
218 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2304 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.331 ms 1 Yes /classes/SpecificPrice.php:576
182 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2298 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.329 ms 1 Yes /classes/SpecificPrice.php:576
774 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1623) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
 0.329 ms 1 Yes /classes/Product.php:4513
553 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1584 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.328 ms 1 Yes /classes/SpecificPrice.php:576
122 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2286 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.328 ms 1 Yes /classes/SpecificPrice.php:576
790 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > 0, 1, 0)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN prstshp_stock_available stock
ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, 0) AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 2)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (1472) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
HAVING qty > 0
ORDER BY a.`position` ASC;
 0.328 ms 1 Yes /classes/Product.php:4513
747 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 1473
ORDER BY `position`
 0.326 ms 2 Yes /classes/Product.php:3539
607 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1492 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1492 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.325 ms 0 /classes/Cart.php:1430
127 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2286 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2286 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.324 ms 0 /classes/Cart.php:1430
647 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1476) AND (b.`id_shop` = 1) LIMIT 1
 0.324 ms 1 /src/Adapter/EntityMapper.php:71
469 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1625 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.323 ms 1 Yes /classes/SpecificPrice.php:576
194 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2301 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.321 ms 1 Yes /classes/SpecificPrice.php:576
481 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1623 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.321 ms 1 Yes /classes/SpecificPrice.php:576
505 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1615 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.321 ms 1 Yes /classes/SpecificPrice.php:576
577 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1574 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.321 ms 1 Yes /classes/SpecificPrice.php:576
1 
SELECT SQL_NO_CACHE gs.*, s.*, gs.name AS group_name, s.name AS shop_name, s.active, su.domain, su.domain_ssl, su.physical_uri, su.virtual_uri
FROM prstshp_shop_group gs
LEFT JOIN prstshp_shop s
ON s.id_shop_group = gs.id_shop_group
LEFT JOIN prstshp_shop_url su
ON s.id_shop = su.id_shop AND su.main = 1
WHERE s.deleted = 0
AND gs.deleted = 0
ORDER BY gs.name, s.name
 0.320 ms 1 Yes /classes/shop/Shop.php:715
223 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2304 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2304 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.320 ms 0 /classes/Cart.php:1430
325 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2328 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.320 ms 1 Yes /classes/SpecificPrice.php:576
635 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1477) AND (b.`id_shop` = 1) LIMIT 1
 0.319 ms 1 /src/Adapter/EntityMapper.php:71
732 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 1492
ORDER BY `position`
 0.319 ms 3 Yes /classes/Product.php:3539
146 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2295 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.316 ms 1 Yes /classes/SpecificPrice.php:576
187 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2298 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2298 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.316 ms 0 /classes/Cart.php:1430
230 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2309 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.314 ms 1 Yes /classes/SpecificPrice.php:576
277 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2318 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.313 ms 1 Yes /classes/SpecificPrice.php:576
259 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2315 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2315 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.312 ms 0 /classes/Cart.php:1430
242 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2313 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.310 ms 1 Yes /classes/SpecificPrice.php:576
139 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2287 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2287 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.309 ms 0 /classes/Cart.php:1430
337 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2336 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.309 ms 1 Yes /classes/SpecificPrice.php:576
462 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1627 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1627 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.309 ms 0 /classes/Cart.php:1430
80 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2284
AND image_shop.`cover` = 1 LIMIT 1
 0.308 ms 1 /classes/Product.php:3570
405 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1664) AND (b.`id_shop` = 1) LIMIT 1
 0.308 ms 1 /src/Adapter/EntityMapper.php:71
235 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2309 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2309 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.308 ms 0 /classes/Cart.php:1430
254 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2315 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.306 ms 1 Yes /classes/SpecificPrice.php:576
306 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2324 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2324 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.306 ms 0 /classes/Cart.php:1430
517 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1593 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.305 ms 1 Yes /classes/SpecificPrice.php:576
128 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2286
ORDER BY f.position ASC
 0.305 ms 1 Yes /classes/Product.php:6024
175 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2297 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2297 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.305 ms 0 /classes/Cart.php:1430
541 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1588 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.305 ms 1 Yes /classes/SpecificPrice.php:576
717 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 1588
ORDER BY `position`
 0.305 ms 2 Yes /classes/Product.php:3539
546 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1588 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1588 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.304 ms 0 /classes/Cart.php:1430
565 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1579 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.304 ms 1 Yes /classes/SpecificPrice.php:576
588 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1512 LIMIT 1
 0.304 ms 1 /classes/SpecificPrice.php:435
599 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1492) AND (b.`id_shop` = 1) LIMIT 1
 0.303 ms 1 /src/Adapter/EntityMapper.php:71
671 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1472) AND (b.`id_shop` = 1) LIMIT 1
 0.302 ms 1 /src/Adapter/EntityMapper.php:71
170 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2297 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.301 ms 1 Yes /classes/SpecificPrice.php:576
384 
SELECT SQL_NO_CACHE c.*, cl.*
FROM `prstshp_category` c
LEFT JOIN `prstshp_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 2 AND cl.id_shop = 1 )
WHERE `name` = 'JOYAS DE PLATA'
AND c.`id_category` != 2
AND c.`id_parent` = 2 LIMIT 1
 0.300 ms 2 /classes/Category.php:1492
115 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2285 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2285 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.300 ms 0 /classes/Cart.php:1430
151 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2295 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2295 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.300 ms 0 /classes/Cart.php:1430
529 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 1591 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.300 ms 1 Yes /classes/SpecificPrice.php:576
558 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1584 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1584 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.297 ms 0 /classes/Cart.php:1430
791 
SELECT SQL_NO_CACHE * FROM prstshp_corewhatsapp WHERE core_status=1 AND FIND_IN_SET('2', `core_language`)  LIMIT 0,1
 0.297 ms 1 /modules/corewhatsapp/corewhatsapp.php:169
349 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2340 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.296 ms 1 Yes /classes/SpecificPrice.php:576
289 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2321 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.295 ms 1 Yes /classes/SpecificPrice.php:576
597 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1492
AND image_shop.`cover` = 1 LIMIT 1
 0.294 ms 3 /classes/Product.php:3570
131 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2287) AND (b.`id_shop` = 1) LIMIT 1
 0.294 ms 1 /src/Adapter/EntityMapper.php:71
313 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2327 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.294 ms 1 Yes /classes/SpecificPrice.php:576
486 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1623 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1623 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.294 ms 0 /classes/Cart.php:1430
381 
SELECT SQL_NO_CACHE `name`
FROM `prstshp_hook`
WHERE `id_hook` = 746 LIMIT 1
 0.293 ms 1 /classes/Hook.php:244
510 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1615 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1615 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.291 ms 0 /classes/Cart.php:1430
211 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2303 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2303 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.291 ms 0 /classes/Cart.php:1430
119 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2286) AND (b.`id_shop` = 1) LIMIT 1
 0.290 ms 1 /src/Adapter/EntityMapper.php:71
203 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2303) AND (b.`id_shop` = 1) LIMIT 1
 0.290 ms 1 /src/Adapter/EntityMapper.php:71
361 
SELECT SQL_NO_CACHE *, ( IF (`id_group` = 1, 2, 0) +  IF (`id_country` = 6, 4, 0) +  IF (`id_currency` = 2, 8, 0) +  IF (`id_shop` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `prstshp_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 2) AND
`id_country` IN (0, 6) AND
`id_group` IN (0, 1) AND `id_product` = 2344 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-13 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.289 ms 1 Yes /classes/SpecificPrice.php:576
270 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2317 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2317 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.288 ms 0 /classes/Cart.php:1430
453 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1627) AND (b.`id_shop` = 1) LIMIT 1
 0.288 ms 1 /src/Adapter/EntityMapper.php:71
18 
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `prstshp_module` m
LEFT JOIN `prstshp_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
 0.286 ms 102 /classes/module/Module.php:341
318 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2327 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2327 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.286 ms 0 /classes/Cart.php:1430
627 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1485)
 0.285 ms 1 /classes/Product.php:3860
534 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1591 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1591 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.284 ms 0 /classes/Cart.php:1430
414 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1664
ORDER BY f.position ASC
 0.283 ms 1 Yes /classes/Product.php:6024
474 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1625 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1625 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.281 ms 0 /classes/Cart.php:1430
382 
SELECT SQL_NO_CACHE `id_category`
FROM `prstshp_category_shop`
WHERE `id_category` = 2
AND `id_shop` = 1 LIMIT 1
 0.280 ms 1 /classes/Category.php:2446
429 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1661) AND (b.`id_shop` = 1) LIMIT 1
 0.279 ms 1 /src/Adapter/EntityMapper.php:71
514 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1593) AND (b.`id_shop` = 1) LIMIT 1
 0.279 ms 1 /src/Adapter/EntityMapper.php:71
522 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1593 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1593 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.279 ms 0 /classes/Cart.php:1430
498 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1618 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1618 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.278 ms 0 /classes/Cart.php:1430
212 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2303
ORDER BY f.position ASC
 0.277 ms 1 Yes /classes/Product.php:6024
330 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2328 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2328 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.277 ms 0 /classes/Cart.php:1430
611 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1487) AND (b.`id_shop` = 1) LIMIT 1
 0.277 ms 1 /src/Adapter/EntityMapper.php:71
294 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2321 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2321 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.275 ms 0 /classes/Cart.php:1430
668 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1473
ORDER BY f.position ASC
 0.275 ms 1 Yes /classes/Product.php:6024
570 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 1579 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 1579 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.274 ms 0 /classes/Cart.php:1430
342 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2336 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2336 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.273 ms 0 /classes/Cart.php:1430
593 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1512 AND `id_group` = 1 LIMIT 1
 0.273 ms 0 /classes/GroupReduction.php:153
675 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1472)
 0.272 ms 1 /classes/Product.php:3860
526 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1591) AND (b.`id_shop` = 1) LIMIT 1
 0.271 ms 1 /src/Adapter/EntityMapper.php:71
71 
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a0
LEFT JOIN `prstshp_category_lang` `a1` ON (a0.`id_category` = a1.`id_category`)
WHERE (a0.`nleft` < 2) AND (a0.`nright` > 197) AND (a1.`id_lang` = 2) AND (a1.`id_shop` = 1)
ORDER BY a0.`nleft` asc
 0.271 ms 1 /classes/PrestaShopCollection.php:383
163 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2296 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2296 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.271 ms 0 /classes/Cart.php:1430
392 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1672) AND (b.`id_shop` = 1) LIMIT 1
 0.270 ms 1 /src/Adapter/EntityMapper.php:71
107 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2285) AND (b.`id_shop` = 1) LIMIT 1
 0.270 ms 1 /src/Adapter/EntityMapper.php:71
227 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2309) AND (b.`id_shop` = 1) LIMIT 1
 0.269 ms 1 /src/Adapter/EntityMapper.php:71
591 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1512)
 0.269 ms 1 /classes/Product.php:3860
191 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2301) AND (b.`id_shop` = 1) LIMIT 1
 0.268 ms 1 /src/Adapter/EntityMapper.php:71
366 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2344 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2344 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.268 ms 0 /classes/Cart.php:1430
690 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 1661
ORDER BY `position`
 0.268 ms 3 Yes /classes/Product.php:3539
402 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1672
ORDER BY f.position ASC
 0.267 ms 1 Yes /classes/Product.php:6024
608 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1492
ORDER BY f.position ASC
 0.267 ms 1 Yes /classes/Product.php:6024
354 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2340 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2340 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.265 ms 0 /classes/Cart.php:1430
83 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2284) AND (b.`id_shop` = 1) LIMIT 1
 0.264 ms 1 /src/Adapter/EntityMapper.php:71
215 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2304) AND (b.`id_shop` = 1) LIMIT 1
 0.264 ms 1 /src/Adapter/EntityMapper.php:71
378 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2347 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2347 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.264 ms 0 /classes/Cart.php:1430
441 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1660) AND (b.`id_shop` = 1) LIMIT 1
 0.263 ms 1 /src/Adapter/EntityMapper.php:71
282 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2318 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2318 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.262 ms 0 /classes/Cart.php:1430
179 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2298) AND (b.`id_shop` = 1) LIMIT 1
 0.261 ms 1 /src/Adapter/EntityMapper.php:71
247 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 2313 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 2313 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.260 ms 0 /classes/Cart.php:1430
639 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1477)
 0.258 ms 1 /classes/Product.php:3860
103 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2284
ORDER BY f.position ASC
 0.257 ms 1 Yes /classes/Product.php:6024
438 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1661
ORDER BY f.position ASC
 0.256 ms 1 Yes /classes/Product.php:6024
663 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1473)
 0.255 ms 1 /classes/Product.php:3860
426 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1663
ORDER BY f.position ASC
 0.255 ms 1 Yes /classes/Product.php:6024
152 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2295
ORDER BY f.position ASC
 0.254 ms 1 Yes /classes/Product.php:6024
417 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1663) AND (b.`id_shop` = 1) LIMIT 1
 0.251 ms 1 /src/Adapter/EntityMapper.php:71
286 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2321) AND (b.`id_shop` = 1) LIMIT 1
 0.250 ms 1 /src/Adapter/EntityMapper.php:71
696 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 1627
ORDER BY `position`
 0.250 ms 1 Yes /classes/Product.php:3539
734 
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (1512) AND il.`id_lang` = 2 ORDER by i.`position`
 0.249 ms 1 Yes /classes/Product.php:2915
547 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1588
ORDER BY f.position ASC
 0.249 ms 1 Yes /classes/Product.php:6024
200 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2301
ORDER BY f.position ASC
 0.246 ms 1 Yes /classes/Product.php:6024
800 
SELECT SQL_NO_CACHE `id_guest`
FROM `prstshp_connections`
WHERE `id_guest` = 16684218
AND `date_add` > '2026-04-13 11:18:00'
AND id_shop IN (1) 
ORDER BY `date_add` DESC LIMIT 1
 0.245 ms 1 Yes /classes/Connection.php:168
116 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2285
ORDER BY f.position ASC
 0.244 ms 1 Yes /classes/Product.php:6024
463 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1627
ORDER BY f.position ASC
 0.243 ms 1 Yes /classes/Product.php:6024
750 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 1472
ORDER BY `position`
 0.243 ms 2 Yes /classes/Product.php:3539
248 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2313
ORDER BY f.position ASC
 0.242 ms 1 Yes /classes/Product.php:6024
334 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2336) AND (b.`id_shop` = 1) LIMIT 1
 0.242 ms 1 /src/Adapter/EntityMapper.php:71
562 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1579) AND (b.`id_shop` = 1) LIMIT 1
 0.242 ms 1 /src/Adapter/EntityMapper.php:71
686 
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (1927) AND il.`id_lang` = 2 ORDER by i.`position`
 0.241 ms 1 Yes /classes/Product.php:2915
188 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2298
ORDER BY f.position ASC
 0.240 ms 1 Yes /classes/Product.php:6024
466 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1625) AND (b.`id_shop` = 1) LIMIT 1
 0.240 ms 1 /src/Adapter/EntityMapper.php:71
95 
SELECT SQL_NO_CACHE tr.*
FROM `prstshp_tax_rule` tr
JOIN `prstshp_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 6
AND tr.`id_tax_rules_group` = 53
AND tr.`id_state` IN (0, 362)
AND ('08720' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '08720')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
 0.239 ms 2 /classes/tax/TaxRulesTaxManager.php:100
167 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2297) AND (b.`id_shop` = 1) LIMIT 1
 0.239 ms 1 /src/Adapter/EntityMapper.php:71
319 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2327
ORDER BY f.position ASC
 0.239 ms 1 Yes /classes/Product.php:6024
143 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2295) AND (b.`id_shop` = 1) LIMIT 1
 0.238 ms 1 /src/Adapter/EntityMapper.php:71
322 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2328) AND (b.`id_shop` = 1) LIMIT 1
 0.238 ms 1 /src/Adapter/EntityMapper.php:71
346 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2340) AND (b.`id_shop` = 1) LIMIT 1
 0.237 ms 1 /src/Adapter/EntityMapper.php:71
224 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2304
ORDER BY f.position ASC
 0.236 ms 1 Yes /classes/Product.php:6024
603 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1492)
 0.236 ms 1 /classes/Product.php:3860
251 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2315) AND (b.`id_shop` = 1) LIMIT 1
 0.233 ms 1 /src/Adapter/EntityMapper.php:71
236 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2309
ORDER BY f.position ASC
 0.233 ms 1 Yes /classes/Product.php:6024
176 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2297
ORDER BY f.position ASC
 0.232 ms 1 Yes /classes/Product.php:6024
421 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1663)
 0.232 ms 1 /classes/Product.php:3860
523 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1593
ORDER BY f.position ASC
 0.232 ms 1 Yes /classes/Product.php:6024
538 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1588) AND (b.`id_shop` = 1) LIMIT 1
 0.231 ms 1 /src/Adapter/EntityMapper.php:71
358 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2344) AND (b.`id_shop` = 1) LIMIT 1
 0.231 ms 1 /src/Adapter/EntityMapper.php:71
657 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1473
AND image_shop.`cover` = 1 LIMIT 1
 0.230 ms 2 /classes/Product.php:3570
571 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1579
ORDER BY f.position ASC
 0.230 ms 1 Yes /classes/Product.php:6024
738 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 1485
ORDER BY `position`
 0.230 ms 1 Yes /classes/Product.php:3539
239 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2313) AND (b.`id_shop` = 1) LIMIT 1
 0.229 ms 1 /src/Adapter/EntityMapper.php:71
475 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1625
ORDER BY f.position ASC
 0.228 ms 1 Yes /classes/Product.php:6024
370 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2347) AND (b.`id_shop` = 1) LIMIT 1
 0.228 ms 1 /src/Adapter/EntityMapper.php:71
711 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 1593
ORDER BY `position`
 0.228 ms 2 Yes /classes/Product.php:3539
264 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2317) AND (b.`id_shop` = 1) LIMIT 1
 0.227 ms 1 /src/Adapter/EntityMapper.php:71
367 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2344
ORDER BY f.position ASC
 0.227 ms 1 Yes /classes/Product.php:6024
450 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1660
ORDER BY f.position ASC
 0.227 ms 1 Yes /classes/Product.php:6024
502 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1615) AND (b.`id_shop` = 1) LIMIT 1
 0.227 ms 1 /src/Adapter/EntityMapper.php:71
550 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1584) AND (b.`id_shop` = 1) LIMIT 1
 0.227 ms 1 /src/Adapter/EntityMapper.php:71
478 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1623) AND (b.`id_shop` = 1) LIMIT 1
 0.226 ms 1 /src/Adapter/EntityMapper.php:71
535 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1591
ORDER BY f.position ASC
 0.226 ms 1 Yes /classes/Product.php:6024
583 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1574
ORDER BY f.position ASC
 0.225 ms 1 Yes /classes/Product.php:6024
11 
SELECT SQL_NO_CACHE COUNT(DISTINCT l.id_lang) FROM `prstshp_lang` l
JOIN prstshp_lang_shop lang_shop ON (lang_shop.id_lang = l.id_lang AND lang_shop.id_shop = 1)
WHERE l.`active` = 1 LIMIT 1
 0.224 ms 4 /classes/Language.php:1214
274 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2318) AND (b.`id_shop` = 1) LIMIT 1
 0.223 ms 1 /src/Adapter/EntityMapper.php:71
140 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2287
ORDER BY f.position ASC
 0.222 ms 1 Yes /classes/Product.php:6024
487 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1623
ORDER BY f.position ASC
 0.222 ms 1 Yes /classes/Product.php:6024
693 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 1660
ORDER BY `position`
 0.222 ms 3 Yes /classes/Product.php:3539
802 
SELECT SQL_NO_CACHE `id_page`
FROM `prstshp_page`
WHERE `id_page_type` = 5 AND `id_object` = 2 LIMIT 1
 0.222 ms 1 /classes/Page.php:83
343 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2336
ORDER BY f.position ASC
 0.221 ms 1 Yes /classes/Product.php:6024
511 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1615
ORDER BY f.position ASC
 0.221 ms 1 Yes /classes/Product.php:6024
805 
SELECT SQL_NO_CACHE m.* FROM `prstshp_module` m
 0.220 ms 102 /classes/module/Module.php:1724
559 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1584
ORDER BY f.position ASC
 0.220 ms 1 Yes /classes/Product.php:6024
692 
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (1924) AND il.`id_lang` = 2 ORDER by i.`position`
 0.219 ms 1 Yes /classes/Product.php:2915
91 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2284)
 0.218 ms 1 /classes/Product.php:3860
331 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2328
ORDER BY f.position ASC
 0.218 ms 1 Yes /classes/Product.php:6024
499 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 1618
ORDER BY f.position ASC
 0.217 ms 1 Yes /classes/Product.php:6024
707 
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (1880) AND il.`id_lang` = 2 ORDER by i.`position`
 0.217 ms 1 Yes /classes/Product.php:2915
720 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 1584
ORDER BY `position`
 0.217 ms 2 Yes /classes/Product.php:3539
729 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 1512
ORDER BY `position`
 0.217 ms 1 Yes /classes/Product.php:3539
298 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2324) AND (b.`id_shop` = 1) LIMIT 1
 0.216 ms 1 /src/Adapter/EntityMapper.php:71
554 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1584)
 0.216 ms 1 /classes/Product.php:3860
111 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2285)
 0.215 ms 1 /classes/Product.php:3860
574 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1574) AND (b.`id_shop` = 1) LIMIT 1
 0.215 ms 1 /src/Adapter/EntityMapper.php:71
490 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 1618) AND (b.`id_shop` = 1) LIMIT 1
 0.214 ms 1 /src/Adapter/EntityMapper.php:71
76 
SELECT SQL_NO_CACHE `id_configuration`
FROM `prstshp_configuration`
WHERE name = 'PS_ACCOUNTS_SHOP_STATUS'
AND (id_shop_group IS NULL OR id_shop_group = 0) AND (id_shop IS NULL OR id_shop = 0) LIMIT 1
 0.214 ms 1 /classes/Configuration.php:133
307 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2324
ORDER BY f.position ASC
 0.211 ms 1 Yes /classes/Product.php:6024
310 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2327) AND (b.`id_shop` = 1) LIMIT 1
 0.210 ms 1 /src/Adapter/EntityMapper.php:71
385 
SELECT SQL_NO_CACHE c.*, cl.*
FROM `prstshp_category` c
LEFT JOIN `prstshp_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 2 AND cl.id_shop = 1 )
WHERE `name` = 'ORO 14K'
AND c.`id_category` != 2
AND c.`id_parent` = 2 LIMIT 1
 0.210 ms 3 /classes/Category.php:1492
615 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1487)
 0.210 ms 1 /classes/Product.php:3860
726 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 1574
ORDER BY `position`
 0.209 ms 1 Yes /classes/Product.php:3539
735 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 1487
ORDER BY `position`
 0.209 ms 2 Yes /classes/Product.php:3539
183 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2298)
 0.208 ms 1 /classes/Product.php:3860
104 
SELECT SQL_NO_CACHE tr.*
FROM `prstshp_tax_rule` tr
JOIN `prstshp_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 6
AND tr.`id_tax_rules_group` = 53
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
 0.208 ms 1 /classes/tax/TaxRulesTaxManager.php:100
260 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2315
ORDER BY f.position ASC
 0.208 ms 1 Yes /classes/Product.php:6024
689 
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (1926) AND il.`id_lang` = 2 ORDER by i.`position`
 0.208 ms 1 Yes /classes/Product.php:2915
355 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2340
ORDER BY f.position ASC
 0.207 ms 1 Yes /classes/Product.php:6024
757 
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module` WHERE `name` = "iqitlinksmanager" LIMIT 1
 0.207 ms 1 /classes/module/Module.php:2664
155 
SELECT SQL_NO_CACHE *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 2
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 2296) AND (b.`id_shop` = 1) LIMIT 1
 0.207 ms 1 /src/Adapter/EntityMapper.php:71
271 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2317
ORDER BY f.position ASC
 0.207 ms 1 Yes /classes/Product.php:6024
390 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1672
AND image_shop.`cover` = 1 LIMIT 1
 0.207 ms 3 /classes/Product.php:3570
744 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 1476
ORDER BY `position`
 0.207 ms 2 Yes /classes/Product.php:3539
283 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2318
ORDER BY f.position ASC
 0.206 ms 1 Yes /classes/Product.php:6024
374 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2347)
 0.206 ms 1 /classes/Product.php:3860
397 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1672)
 0.206 ms 1 /classes/Product.php:3860
409 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1664)
 0.206 ms 1 /classes/Product.php:3860
633 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1477
AND image_shop.`cover` = 1 LIMIT 1
 0.205 ms 2 /classes/Product.php:3570
135 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2287)
 0.204 ms 1 /classes/Product.php:3860
714 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 1591
ORDER BY `position`
 0.204 ms 2 Yes /classes/Product.php:3539
379 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2347
ORDER BY f.position ASC
 0.204 ms 1 Yes /classes/Product.php:6024
645 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1476
AND image_shop.`cover` = 1 LIMIT 1
 0.204 ms 2 /classes/Product.php:3570
164 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2296
ORDER BY f.position ASC
 0.203 ms 1 Yes /classes/Product.php:6024
705 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 1618
ORDER BY `position`
 0.203 ms 1 Yes /classes/Product.php:3539
702 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 1623
ORDER BY `position`
 0.202 ms 1 Yes /classes/Product.php:3539
295 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 2)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 2)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 2)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 2321
ORDER BY f.position ASC
 0.201 ms 1 Yes /classes/Product.php:6024
731 
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (1532) AND il.`id_lang` = 2 ORDER by i.`position`
 0.201 ms 1 Yes /classes/Product.php:2915
741 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 1477
ORDER BY `position`
 0.200 ms 2 Yes /classes/Product.php:3539
708 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 1615
ORDER BY `position`
 0.199 ms 1 Yes /classes/Product.php:3539
171 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2297)
 0.198 ms 1 /classes/Product.php:3860
20 
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 2) AND (b.`id_shop` = 1) LIMIT 1
 0.196 ms 1 /src/Adapter/EntityMapper.php:71
41 
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 14) AND (b.`id_shop` = 1) LIMIT 1
 0.196 ms 1 /src/Adapter/EntityMapper.php:71
386 
SELECT SQL_NO_CACHE c.*, cl.*
FROM `prstshp_category` c
LEFT JOIN `prstshp_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 2 AND cl.id_shop = 1 )
WHERE `name` = 'COMUNIÓN'
AND c.`id_category` != 2
AND c.`id_parent` = 2 LIMIT 1
 0.195 ms 2 /classes/Category.php:1492
415 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1663
AND image_shop.`cover` = 1 LIMIT 1
 0.195 ms 3 /classes/Product.php:3570
74 
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module` WHERE `name` = "ps_accounts" LIMIT 1
 0.194 ms 1 /src/Adapter/Module/ModuleDataProvider.php:256
699 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 1625
ORDER BY `position`
 0.194 ms 1 Yes /classes/Product.php:3539
123 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2286)
 0.193 ms 1 /classes/Product.php:3860
669 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1472
AND image_shop.`cover` = 1 LIMIT 1
 0.192 ms 2 /classes/Product.php:3570
723 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 2)
WHERE i.`id_product` = 1579
ORDER BY `position`
 0.192 ms 1 Yes /classes/Product.php:3539
207 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2303)
 0.191 ms 1 /classes/Product.php:3860
117 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2286
AND image_shop.`cover` = 1 LIMIT 1
 0.190 ms 1 /classes/Product.php:3570
433 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1661)
 0.190 ms 1 /classes/Product.php:3860
749 
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (1493) AND il.`id_lang` = 2 ORDER by i.`position`
 0.189 ms 1 Yes /classes/Product.php:2915
219 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2304)
 0.186 ms 1 /classes/Product.php:3860
439 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1660
AND image_shop.`cover` = 1 LIMIT 1
 0.186 ms 3 /classes/Product.php:3570
427 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1661
AND image_shop.`cover` = 1 LIMIT 1
 0.185 ms 3 /classes/Product.php:3570
752 
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (1492) AND il.`id_lang` = 2 ORDER by i.`position`
 0.185 ms 1 Yes /classes/Product.php:2915
6 
SELECT SQL_NO_CACHE *
FROM `prstshp_country` a
LEFT JOIN `prstshp_country_lang` `b` ON a.`id_country` = b.`id_country` AND b.`id_lang` = 2
LEFT JOIN `prstshp_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 6) LIMIT 1
 0.183 ms 1 /src/Adapter/EntityMapper.php:71
380 
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a0
LEFT JOIN `prstshp_category_lang` `a1` ON (a0.`id_category` = a1.`id_category`)
WHERE (a0.`nleft` < 2) AND (a0.`nright` > 197) AND (a1.`id_lang` = 2) AND (a1.`id_shop` = 1)
ORDER BY a0.`nleft` asc
 0.183 ms 1 /classes/PrestaShopCollection.php:383
764 
SELECT SQL_NO_CACHE SUM(`quantity`)
FROM `prstshp_cart_product`
WHERE `id_cart` = 0 LIMIT 1
 0.183 ms 1 /classes/Cart.php:1300
542 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1588)
 0.182 ms 1 /classes/Product.php:3860
566 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1579)
 0.182 ms 1 /classes/Product.php:3860
195 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2301)
 0.181 ms 1 /classes/Product.php:3860
518 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1593)
 0.181 ms 1 /classes/Product.php:3860
796 
SELECT SQL_NO_CACHE psgdprl.message FROM `prstshp_psgdpr_consent` psgdpr
LEFT JOIN prstshp_psgdpr_consent_lang psgdprl ON (psgdpr.id_gdpr_consent = psgdprl.id_gdpr_consent)
WHERE psgdpr.id_module = 22 AND psgdprl.id_lang =2 LIMIT 1
 0.181 ms 8 /modules/psgdpr/classes/GDPRConsent.php:108
704 
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (1885) AND il.`id_lang` = 2 ORDER by i.`position`
 0.180 ms 1 Yes /classes/Product.php:2915
451 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1627
AND image_shop.`cover` = 1 LIMIT 1
 0.180 ms 1 /classes/Product.php:3570
326 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2328)
 0.179 ms 1 /classes/Product.php:3860
740 
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (1505) AND il.`id_lang` = 2 ORDER by i.`position`
 0.179 ms 1 Yes /classes/Product.php:2915
105 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2285
AND image_shop.`cover` = 1 LIMIT 1
 0.178 ms 1 /classes/Product.php:3570
338 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2336)
 0.177 ms 1 /classes/Product.php:3860
403 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1664
AND image_shop.`cover` = 1 LIMIT 1
 0.177 ms 3 /classes/Product.php:3570
621 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1485
AND image_shop.`cover` = 1 LIMIT 1
 0.177 ms 1 /classes/Product.php:3570
25 
SELECT SQL_NO_CACHE *
FROM `prstshp_currency` a
LEFT JOIN `prstshp_currency_lang` `b` ON a.`id_currency` = b.`id_currency` AND b.`id_lang` = 2
LEFT JOIN `prstshp_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 2) LIMIT 1
 0.175 ms 1 /src/Adapter/EntityMapper.php:71
609 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1487
AND image_shop.`cover` = 1 LIMIT 1
 0.175 ms 2 /classes/Product.php:3570
129 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2287
AND image_shop.`cover` = 1 LIMIT 1
 0.174 ms 1 /classes/Product.php:3570
231 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2309)
 0.173 ms 1 /classes/Product.php:3860
445 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1660)
 0.173 ms 1 /classes/Product.php:3860
748 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 1473
 0.172 ms 1 /classes/Product.php:2899
470 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1625)
 0.171 ms 1 /classes/Product.php:3860
530 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1591)
 0.171 ms 1 /classes/Product.php:3860
728 
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (1594) AND il.`id_lang` = 2 ORDER by i.`position`
 0.170 ms 1 Yes /classes/Product.php:2915
40 
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 96) AND (b.`id_shop` = 1) LIMIT 1
 0.169 ms 1 /src/Adapter/EntityMapper.php:71
243 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2313)
 0.169 ms 1 /classes/Product.php:3860
302 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2324)
 0.168 ms 1 /classes/Product.php:3860
733 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 1492
 0.168 ms 1 /classes/Product.php:2899
716 
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (1852) AND il.`id_lang` = 2 ORDER by i.`position`
 0.167 ms 1 Yes /classes/Product.php:2915
350 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2340)
 0.167 ms 1 /classes/Product.php:3860
72 
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module` WHERE `name` = "ps_facebook" LIMIT 1
 0.166 ms 1 /classes/module/Module.php:2664
255 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2315)
 0.166 ms 1 /classes/Product.php:3860
8 
SELECT SQL_NO_CACHE *
FROM `prstshp_lang` a
LEFT JOIN `prstshp_lang_shop` `c` ON a.`id_lang` = c.`id_lang` AND c.`id_shop` = 1
WHERE (a.`id_lang` = 2) LIMIT 1
 0.166 ms 1 /src/Adapter/EntityMapper.php:71
159 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2296)
 0.166 ms 1 /classes/Product.php:3860
362 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2344)
 0.166 ms 1 /classes/Product.php:3860
584 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1512
AND image_shop.`cover` = 1 LIMIT 1
 0.166 ms 1 /classes/Product.php:3570
612 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1487 LIMIT 1
 0.166 ms 1 /classes/SpecificPrice.php:435
21 
SELECT SQL_NO_CACHE * FROM `prstshp_currency` c ORDER BY `iso_code` ASC
 0.164 ms 2 Yes /classes/Currency.php:708
168 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 2297 LIMIT 1
 0.164 ms 1 /classes/SpecificPrice.php:435
746 
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (1496) AND il.`id_lang` = 2 ORDER by i.`position`
 0.164 ms 1 Yes /classes/Product.php:2915
46 
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 16) AND (b.`id_shop` = 1) LIMIT 1
 0.163 ms 1 /src/Adapter/EntityMapper.php:71
482 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1623)
 0.163 ms 1 /classes/Product.php:3860
213 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2304
AND image_shop.`cover` = 1 LIMIT 1
 0.163 ms 1 /classes/Product.php:3570
719 
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (1849) AND il.`id_lang` = 2 ORDER by i.`position`
 0.162 ms 1 Yes /classes/Product.php:2915
249 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2315
AND image_shop.`cover` = 1 LIMIT 1
 0.162 ms 1 /classes/Product.php:3570
147 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2295)
 0.161 ms 1 /classes/Product.php:3860
278 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2318)
 0.160 ms 1 /classes/Product.php:3860
494 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1618)
 0.159 ms 1 /classes/Product.php:3860
759 
SELECT SQL_NO_CACHE COUNT(DISTINCT c.id_currency) FROM `prstshp_currency` c
LEFT JOIN prstshp_currency_shop cs ON (cs.id_currency = c.id_currency AND cs.id_shop = 1)
WHERE c.`active` = 1 AND c.`deleted` = 0 LIMIT 1
 0.159 ms 2 /classes/Currency.php:1134
506 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1615)
 0.158 ms 1 /classes/Product.php:3860
743 
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (1497) AND il.`id_lang` = 2 ORDER by i.`position`
 0.158 ms 1 Yes /classes/Product.php:2915
201 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2303
AND image_shop.`cover` = 1 LIMIT 1
 0.158 ms 1 /classes/Product.php:3570
654 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1476) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.158 ms 1 /classes/stock/StockAvailable.php:453
578 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 1574)
 0.157 ms 1 /classes/Product.php:3860
308 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2327
AND image_shop.`cover` = 1 LIMIT 1
 0.156 ms 1 /classes/Product.php:3570
524 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1591
AND image_shop.`cover` = 1 LIMIT 1
 0.156 ms 2 /classes/Product.php:3570
710 
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (1877) AND il.`id_lang` = 2 ORDER by i.`position`
 0.156 ms 1 Yes /classes/Product.php:2915
5 
SELECT SQL_NO_CACHE l.*, ls.`id_shop`
FROM `prstshp_lang` l
LEFT JOIN `prstshp_lang_shop` ls ON (l.id_lang = ls.id_lang)
 0.155 ms 2 /classes/Language.php:1080
225 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2309
AND image_shop.`cover` = 1 LIMIT 1
 0.155 ms 1 /classes/Product.php:3570
64 
SELECT SQL_NO_CACHE * FROM `prstshp_image_type` WHERE 1 AND `products` = 1  ORDER BY `width` DESC, `height` DESC, `name`ASC
 0.154 ms 8 Yes /classes/ImageType.php:109
177 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2298
AND image_shop.`cover` = 1 LIMIT 1
 0.154 ms 1 /classes/Product.php:3570
19 
SELECT SQL_NO_CACHE name, alias FROM `prstshp_hook_alias`
 0.153 ms 88 /classes/Hook.php:342
189 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2301
AND image_shop.`cover` = 1 LIMIT 1
 0.153 ms 1 /classes/Product.php:3570
412 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1664) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.153 ms 1 /classes/stock/StockAvailable.php:453
695 
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (1923) AND il.`id_lang` = 2 ORDER by i.`position`
 0.153 ms 1 Yes /classes/Product.php:2915
713 
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (1854) AND il.`id_lang` = 2 ORDER by i.`position`
 0.153 ms 1 Yes /classes/Product.php:2915
290 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2321)
 0.152 ms 1 /classes/Product.php:3860
314 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2327)
 0.152 ms 1 /classes/Product.php:3860
594 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1512) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.152 ms 1 /classes/stock/StockAvailable.php:453
34 
SELECT SQL_NO_CACHE *
FROM `prstshp_group` a
LEFT JOIN `prstshp_group_shop` `c` ON a.`id_group` = c.`id_group` AND c.`id_shop` = 1
WHERE (a.`id_group` = 1) LIMIT 1
 0.151 ms 1 /src/Adapter/EntityMapper.php:71
464 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1625
AND image_shop.`cover` = 1 LIMIT 1
 0.151 ms 1 /classes/Product.php:3570
725 
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (1599) AND il.`id_lang` = 2 ORDER by i.`position`
 0.151 ms 1 Yes /classes/Product.php:2915
682 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 1672
 0.150 ms 1 /classes/Product.php:2899
59 
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 115) AND (b.`id_shop` = 1) LIMIT 1
 0.150 ms 1 /src/Adapter/EntityMapper.php:71
31 
SELECT SQL_NO_CACHE *
FROM `prstshp_currency` a
LEFT JOIN `prstshp_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 2) LIMIT 1
 0.149 ms 1 /src/Adapter/EntityMapper.php:71
43 
SELECT SQL_NO_CACHE * FROM `prstshp_image_type` WHERE 1 AND `categories` = 1  ORDER BY `width` DESC, `height` DESC, `name`ASC
 0.148 ms 8 Yes /classes/ImageType.php:109
237 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2313
AND image_shop.`cover` = 1 LIMIT 1
 0.148 ms 1 /classes/Product.php:3570
368 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2347
AND image_shop.`cover` = 1 LIMIT 1
 0.148 ms 1 /classes/Product.php:3570
407 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1664
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.148 ms 1 /classes/SpecificPrice.php:256
418 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1663 LIMIT 1
 0.148 ms 1 /classes/SpecificPrice.php:435
424 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1663) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.148 ms 1 /classes/stock/StockAvailable.php:453
548 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1584
AND image_shop.`cover` = 1 LIMIT 1
 0.148 ms 2 /classes/Product.php:3570
536 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1588
AND image_shop.`cover` = 1 LIMIT 1
 0.147 ms 2 /classes/Product.php:3570
332 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2336
AND image_shop.`cover` = 1 LIMIT 1
 0.146 ms 2 /classes/Product.php:3570
344 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2340
AND image_shop.`cover` = 1 LIMIT 1
 0.146 ms 2 /classes/Product.php:3570
636 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1477 LIMIT 1
 0.146 ms 1 /classes/SpecificPrice.php:435
624 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1485 LIMIT 1
 0.146 ms 1 /classes/SpecificPrice.php:435
24 
SELECT SQL_NO_CACHE c.id_currency
FROM `prstshp_currency` c
WHERE (iso_code = 'EUR') LIMIT 1
 0.145 ms 1 /classes/Currency.php:893
476 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1623
AND image_shop.`cover` = 1 LIMIT 1
 0.145 ms 1 /classes/Product.php:3570
698 
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (1889) AND il.`id_lang` = 2 ORDER by i.`position`
 0.145 ms 1 Yes /classes/Product.php:2915
500 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1615
AND image_shop.`cover` = 1 LIMIT 1
 0.144 ms 1 /classes/Product.php:3570
512 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1593
AND image_shop.`cover` = 1 LIMIT 1
 0.144 ms 2 /classes/Product.php:3570
745 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 1476
 0.144 ms 1 /classes/Product.php:2899
10 
SELECT SQL_NO_CACHE domain, domain_ssl
FROM prstshp_shop_url
WHERE main = 1
AND id_shop = 1 LIMIT 1
 0.143 ms 1 /classes/shop/ShopUrl.php:178
560 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1579
AND image_shop.`cover` = 1 LIMIT 1
 0.143 ms 1 /classes/Product.php:3570
49 
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 70) AND (b.`id_shop` = 1) LIMIT 1
 0.142 ms 1 /src/Adapter/EntityMapper.php:71
660 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1473 LIMIT 1
 0.142 ms 1 /classes/SpecificPrice.php:435
572 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1574
AND image_shop.`cover` = 1 LIMIT 1
 0.142 ms 1 /classes/Product.php:3570
701 
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (1887) AND il.`id_lang` = 2 ORDER by i.`position`
 0.142 ms 1 Yes /classes/Product.php:2915
47 
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 17) AND (b.`id_shop` = 1) LIMIT 1
 0.141 ms 1 /src/Adapter/EntityMapper.php:71
84 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 0 LIMIT 1
 0.140 ms 1 /classes/SpecificPrice.php:426
488 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 1618
AND image_shop.`cover` = 1 LIMIT 1
 0.140 ms 1 /classes/Product.php:3570
737 
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (1507) AND il.`id_lang` = 2 ORDER by i.`position`
 0.140 ms 1 Yes /classes/Product.php:2915
753 
SELECT SQL_NO_CACHE c.id_elementor FROM prstshp_iqit_elementor_category c WHERE c.id_category = 2 LIMIT 1
 0.140 ms 1 /modules/iqitelementor/src/IqitElementorCategory.php:87
57 
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 122) AND (b.`id_shop` = 1) LIMIT 1
 0.139 ms 1 /src/Adapter/EntityMapper.php:71
100 
SELECT SQL_NO_CACHE tr.*
FROM `prstshp_tax_rule` tr
JOIN `prstshp_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 6
AND tr.`id_tax_rules_group` = 0
AND tr.`id_state` IN (0, 362)
AND ('08720' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '08720')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
 0.139 ms 0 /classes/tax/TaxRulesTaxManager.php:100
153 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2296
AND image_shop.`cover` = 1 LIMIT 1
 0.139 ms 1 /classes/Product.php:3570
165 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2297
AND image_shop.`cover` = 1 LIMIT 1
 0.139 ms 1 /classes/Product.php:3570
184 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 2298 AND id_shop=1 LIMIT 1
 0.139 ms 1 /classes/Product.php:6884
406 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1664 LIMIT 1
 0.139 ms 1 /classes/SpecificPrice.php:435
722 
SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend`
FROM `prstshp_product_attribute_image` pai
LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
WHERE pai.`id_product_attribute` IN (1845) AND il.`id_lang` = 2 ORDER by i.`position`
 0.139 ms 1 Yes /classes/Product.php:2915
60 
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 117) AND (b.`id_shop` = 1) LIMIT 1
 0.138 ms 1 /src/Adapter/EntityMapper.php:71
141 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2295
AND image_shop.`cover` = 1 LIMIT 1
 0.138 ms 1 /classes/Product.php:3570
266 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 2317)
 0.138 ms 1 /classes/Product.php:3860
320 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2328
AND image_shop.`cover` = 1 LIMIT 1
 0.138 ms 1 /classes/Product.php:3570
138 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 2287) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.138 ms 1 /classes/stock/StockAvailable.php:453
272 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2318
AND image_shop.`cover` = 1 LIMIT 1
 0.138 ms 1 /classes/Product.php:3570
48 
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 18) AND (b.`id_shop` = 1) LIMIT 1
 0.136 ms 1 /src/Adapter/EntityMapper.php:71
228 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 2309 LIMIT 1
 0.136 ms 1 /classes/SpecificPrice.php:435
299 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 2324 LIMIT 1
 0.136 ms 1 /classes/SpecificPrice.php:435
51 
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 68) AND (b.`id_shop` = 1) LIMIT 1
 0.136 ms 1 /src/Adapter/EntityMapper.php:71
284 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2321
AND image_shop.`cover` = 1 LIMIT 1
 0.136 ms 1 /classes/Product.php:3570
55 
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 93) AND (b.`id_shop` = 1) LIMIT 1
 0.135 ms 1 /src/Adapter/EntityMapper.php:71
678 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1472) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.135 ms 1 /classes/stock/StockAvailable.php:453
4 
SELECT SQL_NO_CACHE su.physical_uri, su.virtual_uri, su.domain, su.domain_ssl
FROM prstshp_shop s
LEFT JOIN prstshp_shop_url su ON (s.id_shop = su.id_shop)
WHERE s.id_shop = 1
AND s.active = 1 AND s.deleted = 0 AND su.main = 1 LIMIT 1
 0.134 ms 1 /classes/shop/Shop.php:214
23 
SELECT SQL_NO_CACHE value FROM `prstshp_configuration` WHERE `name` = "PS_MULTISHOP_FEATURE_ACTIVE" LIMIT 1
 0.134 ms 1 /classes/shop/Shop.php:1183
53 
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 86) AND (b.`id_shop` = 1) LIMIT 1
 0.134 ms 1 /src/Adapter/EntityMapper.php:71
630 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1485) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.134 ms 1 /classes/stock/StockAvailable.php:453
14 
SELECT SQL_NO_CACHE `name`, `alias` FROM `prstshp_hook_alias`
 0.133 ms 88 /classes/Hook.php:290
86 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE `id_product` != 0 LIMIT 1
 0.133 ms 1808 /classes/SpecificPrice.php:297
261 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2317
AND image_shop.`cover` = 1 LIMIT 1
 0.133 ms 1 /classes/Product.php:3570
356 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2344
AND image_shop.`cover` = 1 LIMIT 1
 0.133 ms 1 /classes/Product.php:3570
442 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1660 LIMIT 1
 0.133 ms 1 /classes/SpecificPrice.php:435
724 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 1579
 0.133 ms 1 /classes/Product.php:2899
715 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 1591
 0.132 ms 1 /classes/Product.php:2899
50 
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 59) AND (b.`id_shop` = 1) LIMIT 1
 0.131 ms 1 /src/Adapter/EntityMapper.php:71
29 
SELECT SQL_NO_CACHE *
FROM `prstshp_currency` a
LEFT JOIN `prstshp_currency_lang` `b` ON a.`id_currency` = b.`id_currency` AND b.`id_lang` = 2
LEFT JOIN `prstshp_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
 0.130 ms 1 /src/Adapter/EntityMapper.php:71
404 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 14 LIMIT 1
 0.130 ms 1 /classes/Product.php:5670
625 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1485
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.129 ms 1 /classes/SpecificPrice.php:256
58 
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 113) AND (b.`id_shop` = 1) LIMIT 1
 0.129 ms 1 /src/Adapter/EntityMapper.php:71
795 
SELECT SQL_NO_CACHE psgdpr.active FROM `prstshp_psgdpr_consent` psgdpr
WHERE psgdpr.id_module = 22 LIMIT 1
 0.129 ms 8 /modules/psgdpr/classes/GDPRConsent.php:130
56 
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 112) AND (b.`id_shop` = 1) LIMIT 1
 0.128 ms 1 /src/Adapter/EntityMapper.php:71
520 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1593 AND `id_group` = 1 LIMIT 1
 0.128 ms 0 /classes/GroupReduction.php:153
670 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.128 ms 1 /classes/Product.php:5670
296 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 2324
AND image_shop.`cover` = 1 LIMIT 1
 0.128 ms 1 /classes/Product.php:3570
648 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1476 LIMIT 1
 0.127 ms 1 /classes/SpecificPrice.php:435
751 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 1472
 0.127 ms 1 /classes/Product.php:2899
347 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 2340 LIMIT 1
 0.127 ms 1 /classes/SpecificPrice.php:435
62 
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module` WHERE `name` = "ps_legalcompliance" LIMIT 1
 0.126 ms 0 /classes/module/Module.php:2664
557 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1584) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.126 ms 1 /classes/stock/StockAvailable.php:453
688 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 1663
 0.126 ms 1 /classes/Product.php:2899
52 
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 79) AND (b.`id_shop` = 1) LIMIT 1
 0.126 ms 1 /src/Adapter/EntityMapper.php:71
400 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1672) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.126 ms 1 /classes/stock/StockAvailable.php:453
666 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1473) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.126 ms 1 /classes/stock/StockAvailable.php:453
394 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1672 LIMIT 1
 0.125 ms 1 /classes/SpecificPrice.php:435
96 
SELECT SQL_NO_CACHE *
FROM `prstshp_tax` a
WHERE (a.`id_tax` = 53) LIMIT 1
 0.125 ms 1 /src/Adapter/EntityMapper.php:71
694 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 1660
 0.125 ms 1 /classes/Product.php:2899
709 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 1615
 0.125 ms 1 /classes/Product.php:2899
132 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 2287 LIMIT 1
 0.124 ms 1 /classes/SpecificPrice.php:435
430 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1661 LIMIT 1
 0.124 ms 1 /classes/SpecificPrice.php:435
661 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1473
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.124 ms 1 /classes/SpecificPrice.php:256
672 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1472 LIMIT 1
 0.124 ms 1 /classes/SpecificPrice.php:435
17 
SELECT SQL_NO_CACHE * FROM `prstshp_hook_module_exceptions`
WHERE `id_shop` IN (1)
 0.123 ms 1 /classes/module/Module.php:2046
54 
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 87) AND (b.`id_shop` = 1) LIMIT 1
 0.123 ms 1 /src/Adapter/EntityMapper.php:71
67 
SELECT SQL_NO_CACHE *
FROM `prstshp_country` a
LEFT JOIN `prstshp_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 6) LIMIT 1
 0.123 ms 1 /src/Adapter/EntityMapper.php:71
101 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 2284) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.123 ms 1 /classes/stock/StockAvailable.php:453
794 
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module_shop` WHERE `id_module` = 22 AND `id_shop` = 1 LIMIT 1
 0.122 ms 1 /classes/module/Module.php:2137
622 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 14 LIMIT 1
 0.122 ms 1 /classes/Product.php:5670
718 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 1588
 0.122 ms 1 /classes/Product.php:2899
691 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 1661
 0.121 ms 1 /classes/Product.php:2899
22 
SELECT SQL_NO_CACHE `id_lang` FROM `prstshp_lang`
WHERE `locale` = 'es-es'
OR `language_code` = 'es-es' LIMIT 1
 0.120 ms 2 /classes/Language.php:880
575 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1574 LIMIT 1
 0.120 ms 1 /classes/SpecificPrice.php:435
35 
SELECT SQL_NO_CACHE *
FROM `prstshp_group_lang`
WHERE `id_group` = 1
 0.120 ms 2 /src/Adapter/EntityMapper.php:79
92 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 2284 AND id_shop=1 LIMIT 1
 0.120 ms 1 /classes/Product.php:6884
440 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 14 LIMIT 1
 0.120 ms 1 /classes/Product.php:5670
448 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1660) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.120 ms 1 /classes/stock/StockAvailable.php:453
600 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1492 LIMIT 1
 0.120 ms 1 /classes/SpecificPrice.php:435
436 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1661) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.119 ms 1 /classes/stock/StockAvailable.php:453
77 
SELECT SQL_NO_CACHE *
FROM `prstshp_configuration` a
WHERE (a.`id_configuration` = 1315) LIMIT 1
 0.119 ms 1 /src/Adapter/EntityMapper.php:71
114 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 2285) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.119 ms 1 /classes/stock/StockAvailable.php:453
613 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1487
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.119 ms 1 /classes/SpecificPrice.php:256
646 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 14 LIMIT 1
 0.119 ms 1 /classes/Product.php:5670
7 
SELECT SQL_NO_CACHE *
FROM `prstshp_shop_group` a
WHERE (a.`id_shop_group` = 1) LIMIT 1
 0.118 ms 1 /src/Adapter/EntityMapper.php:71
186 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 2298) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.118 ms 1 /classes/stock/StockAvailable.php:453
797 
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module` WHERE `name` = "iqitcookielaw" LIMIT 1
 0.118 ms 1 /classes/module/Module.php:2664
174 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 2297) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.117 ms 1 /classes/stock/StockAvailable.php:453
329 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 2328) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.117 ms 1 /classes/stock/StockAvailable.php:453
353 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 2340) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.117 ms 1 /classes/stock/StockAvailable.php:453
393 
SELECT SQL_NO_CACHE `name`
FROM `prstshp_manufacturer`
WHERE `id_manufacturer` = 25
AND `active` = 1 LIMIT 1
 0.117 ms 1 /classes/Manufacturer.php:312
461 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1627) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.117 ms 1 /classes/stock/StockAvailable.php:453
628 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1485 AND id_shop=1 LIMIT 1
 0.117 ms 1 /classes/Product.php:6884
727 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 1574
 0.117 ms 1 /classes/Product.php:2899
703 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 1623
 0.116 ms 1 /classes/Product.php:2899
32 
SELECT SQL_NO_CACHE *
FROM `prstshp_currency_lang`
WHERE `id_currency` = 2
 0.116 ms 2 /src/Adapter/EntityMapper.php:79
447 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1660 AND `id_group` = 1 LIMIT 1
 0.116 ms 0 /classes/GroupReduction.php:153
658 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.116 ms 1 /classes/Product.php:5670
371 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 2347 LIMIT 1
 0.115 ms 1 /classes/SpecificPrice.php:435
653 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1476 AND `id_group` = 1 LIMIT 1
 0.115 ms 0 /classes/GroupReduction.php:153
706 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 1618
 0.115 ms 1 /classes/Product.php:2899
712 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 1593
 0.115 ms 1 /classes/Product.php:2899
37 
SELECT SQL_NO_CACHE `id_category`
FROM `prstshp_category_shop`
WHERE `id_category` = 2
AND `id_shop` = 1 LIMIT 1
 0.115 ms 1 /classes/Category.php:2446
192 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 2301 LIMIT 1
 0.115 ms 1 /classes/SpecificPrice.php:435
419 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1663
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.115 ms 1 /classes/SpecificPrice.php:256
527 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1591 LIMIT 1
 0.115 ms 1 /classes/SpecificPrice.php:435
606 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1492) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.115 ms 1 /classes/stock/StockAvailable.php:453
198 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 2301) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.114 ms 1 /classes/stock/StockAvailable.php:453
42 
SELECT SQL_NO_CACHE state FROM prstshp_feature_flag WHERE name = 'multiple_image_format' LIMIT 1
 0.114 ms 1 /classes/FeatureFlag.php:105
61 
SELECT SQL_NO_CACHE *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 2
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 124) AND (b.`id_shop` = 1) LIMIT 1
 0.114 ms 1 /src/Adapter/EntityMapper.php:71
108 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 2285 LIMIT 1
 0.114 ms 1 /classes/SpecificPrice.php:435
216 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 2304 LIMIT 1
 0.114 ms 1 /classes/SpecificPrice.php:435
222 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 2304) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.114 ms 1 /classes/stock/StockAvailable.php:453
234 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 2309) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.114 ms 1 /classes/stock/StockAvailable.php:453
637 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1477
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.114 ms 1 /classes/SpecificPrice.php:256
323 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 2328 LIMIT 1
 0.113 ms 1 /classes/SpecificPrice.php:435
391 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 14 LIMIT 1
 0.113 ms 1 /classes/Product.php:5670
730 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 1512
 0.113 ms 1 /classes/Product.php:2899
359 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 2344 LIMIT 1
 0.112 ms 1 /classes/SpecificPrice.php:435
3 
SELECT SQL_NO_CACHE *
FROM `prstshp_shop` a
WHERE (a.`id_shop` = 1) LIMIT 1
 0.112 ms 1 /src/Adapter/EntityMapper.php:71
87 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE `from` BETWEEN '2026-04-13 00:00:00' AND '2026-04-13 23:59:59' LIMIT 1
 0.112 ms 1 /classes/SpecificPrice.php:377
124 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 2286 AND id_shop=1 LIMIT 1
 0.112 ms 1 /classes/Product.php:6884
204 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 2303 LIMIT 1
 0.112 ms 1 /classes/SpecificPrice.php:435
428 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 14 LIMIT 1
 0.111 ms 1 /classes/Product.php:5670
545 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1588) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.111 ms 1 /classes/stock/StockAvailable.php:453
634 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 14 LIMIT 1
 0.111 ms 1 /classes/Product.php:5670
120 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 2286 LIMIT 1
 0.111 ms 1 /classes/SpecificPrice.php:435
172 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 2297 AND id_shop=1 LIMIT 1
 0.111 ms 1 /classes/Product.php:6884
398 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1672 AND id_shop=1 LIMIT 1
 0.111 ms 1 /classes/Product.php:6884
73 
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module_shop` WHERE `id_module` = 61 AND `id_shop` = 1 LIMIT 1
 0.110 ms 1 /classes/module/Module.php:2137
130 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.110 ms 1 /classes/Product.php:5670
240 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 2313 LIMIT 1
 0.110 ms 1 /classes/SpecificPrice.php:435
416 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 14 LIMIT 1
 0.109 ms 1 /classes/Product.php:5670
792 
SELECT SQL_NO_CACHE domain,physical_uri FROM prstshp_shop_url
 0.109 ms 1 /modules/corewhatsapp/corewhatsapp.php:179
38 
SELECT SQL_NO_CACHE ctg.`id_group`
FROM prstshp_category_group ctg
WHERE ctg.`id_category` = 2 AND ctg.`id_group` = 1 LIMIT 1
 0.109 ms 1 /classes/Category.php:1751
81 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `prstshp_category_lang` cl
WHERE `id_lang` = 2
AND cl.id_shop = 1 
AND cl.`id_category` = 18 LIMIT 1
 0.109 ms 1 /classes/Category.php:1373
126 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 2286) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.109 ms 1 /classes/stock/StockAvailable.php:453
460 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1627 AND `id_group` = 1 LIMIT 1
 0.109 ms 0 /classes/GroupReduction.php:153
9 
SELECT SQL_NO_CACHE id_shop
FROM `prstshp_lang_shop`
WHERE `id_lang` = 2
AND id_shop = 1 LIMIT 1
 0.108 ms 1 /classes/ObjectModel.php:1727
434 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1661 AND id_shop=1 LIMIT 1
 0.108 ms 1 /classes/Product.php:6884
513 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.108 ms 1 /classes/Product.php:5670
601 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1492
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.108 ms 1 /classes/SpecificPrice.php:256
676 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1472 AND id_shop=1 LIMIT 1
 0.108 ms 1 /classes/Product.php:6884
118 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.107 ms 1 /classes/Product.php:5670
180 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 2298 LIMIT 1
 0.107 ms 1 /classes/SpecificPrice.php:435
431 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1661
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.107 ms 1 /classes/SpecificPrice.php:256
459 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1627 AND id_shop=1 LIMIT 1
 0.107 ms 1 /classes/Product.php:6884
765 
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module` WHERE `name` = "iqitmegamenu" LIMIT 1
 0.107 ms 1 /classes/module/Module.php:2664
190 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.106 ms 1 /classes/Product.php:5670
196 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 2301 AND id_shop=1 LIMIT 1
 0.106 ms 1 /classes/Product.php:6884
208 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 2303 AND id_shop=1 LIMIT 1
 0.106 ms 1 /classes/Product.php:6884
491 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1618 LIMIT 1
 0.106 ms 1 /classes/SpecificPrice.php:435
581 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1574) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.106 ms 1 /classes/stock/StockAvailable.php:453
664 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1473 AND id_shop=1 LIMIT 1
 0.105 ms 1 /classes/Product.php:6884
78 
SELECT SQL_NO_CACHE *
FROM `prstshp_configuration_lang`
WHERE `id_configuration` = 1315
 0.105 ms 1 /src/Adapter/EntityMapper.php:79
106 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.105 ms 1 /classes/Product.php:5670
395 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1672
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.105 ms 1 /classes/SpecificPrice.php:256
422 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1663 AND id_shop=1 LIMIT 1
 0.105 ms 1 /classes/Product.php:6884
742 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 1477
 0.105 ms 1 /classes/Product.php:2899
36 
SELECT SQL_NO_CACHE id_shop
FROM `prstshp_group_shop`
WHERE `id_group` = 1
AND id_shop = 1 LIMIT 1
 0.104 ms 1 /classes/ObjectModel.php:1727
144 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 2295 LIMIT 1
 0.104 ms 1 /classes/SpecificPrice.php:435
521 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1593) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.104 ms 1 /classes/stock/StockAvailable.php:453
739 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 1485
 0.104 ms 1 /classes/Product.php:2899
26 
SELECT SQL_NO_CACHE `id_lang` FROM `prstshp_lang`
WHERE `locale` = 'es-es'
OR `language_code` = 'es-es' LIMIT 1
 0.104 ms 2 /classes/Language.php:880
28 
SELECT SQL_NO_CACHE c.id_currency
FROM `prstshp_currency` c
WHERE (iso_code = 'USD') LIMIT 1
 0.104 ms 1 /classes/Currency.php:893
97 
SELECT SQL_NO_CACHE *
FROM `prstshp_tax_lang`
WHERE `id_tax` = 53
 0.104 ms 2 /src/Adapter/EntityMapper.php:79
202 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.104 ms 1 /classes/Product.php:5670
210 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 2303) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.104 ms 1 /classes/stock/StockAvailable.php:453
220 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 2304 AND id_shop=1 LIMIT 1
 0.104 ms 1 /classes/Product.php:6884
341 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 2336) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.104 ms 1 /classes/stock/StockAvailable.php:453
455 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1627 LIMIT 1
 0.104 ms 1 /classes/SpecificPrice.php:435
467 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1625 LIMIT 1
 0.104 ms 1 /classes/SpecificPrice.php:435
629 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1485 AND `id_group` = 1 LIMIT 1
 0.104 ms 0 /classes/GroupReduction.php:153
760 
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module` WHERE `name` = "ps_languageselector" LIMIT 1
 0.104 ms 1 /classes/module/Module.php:2664
766 
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module_shop` WHERE `id_module` = 78 AND `id_shop` = 1 LIMIT 1
 0.104 ms 1 /classes/module/Module.php:2137
365 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 2344) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.103 ms 1 /classes/stock/StockAvailable.php:453
372 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 2347
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.103 ms 1 /classes/SpecificPrice.php:256
473 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1625) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.103 ms 1 /classes/stock/StockAvailable.php:453
533 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1591) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.103 ms 1 /classes/stock/StockAvailable.php:453
109 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 2285
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.102 ms 0 /classes/SpecificPrice.php:256
410 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1664 AND id_shop=1 LIMIT 1
 0.102 ms 1 /classes/Product.php:6884
443 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1660
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.102 ms 1 /classes/SpecificPrice.php:256
477 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.102 ms 1 /classes/Product.php:5670
539 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1588 LIMIT 1
 0.102 ms 1 /classes/SpecificPrice.php:435
616 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1487 AND id_shop=1 LIMIT 1
 0.102 ms 1 /classes/Product.php:6884
377 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 2347) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.102 ms 1 /classes/stock/StockAvailable.php:453
214 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.101 ms 1 /classes/Product.php:5670
279 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 2318 AND id_shop=1 LIMIT 1
 0.101 ms 1 /classes/Product.php:6884
555 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1584 AND id_shop=1 LIMIT 1
 0.101 ms 1 /classes/Product.php:6884
563 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1579 LIMIT 1
 0.101 ms 1 /classes/SpecificPrice.php:435
677 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1472 AND `id_group` = 1 LIMIT 1
 0.101 ms 0 /classes/GroupReduction.php:153
63 
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.100 ms 0 /classes/module/Module.php:2137
98 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 2284 AND `id_group` = 1 LIMIT 1
 0.100 ms 0 /classes/GroupReduction.php:153
258 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 2315) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.100 ms 1 /classes/stock/StockAvailable.php:453
569 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1579) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.100 ms 1 /classes/stock/StockAvailable.php:453
598 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 14 LIMIT 1
 0.100 ms 1 /classes/Product.php:5670
515 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1593 LIMIT 1
 0.099 ms 1 /classes/SpecificPrice.php:435
85 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 2284 LIMIT 1
 0.099 ms 1 /classes/SpecificPrice.php:435
250 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.099 ms 1 /classes/Product.php:5670
269 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 2317) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.099 ms 1 /classes/stock/StockAvailable.php:453
335 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 2336 LIMIT 1
 0.099 ms 1 /classes/SpecificPrice.php:435
479 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1623 LIMIT 1
 0.099 ms 1 /classes/SpecificPrice.php:435
551 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1584 LIMIT 1
 0.099 ms 1 /classes/SpecificPrice.php:435
112 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 2285 AND id_shop=1 LIMIT 1
 0.098 ms 1 /classes/Product.php:6884
178 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.098 ms 1 /classes/Product.php:5670
503 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1615 LIMIT 1
 0.098 ms 1 /classes/SpecificPrice.php:435
246 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 2313) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.097 ms 1 /classes/stock/StockAvailable.php:453
485 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1623) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.097 ms 1 /classes/stock/StockAvailable.php:453
497 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1618) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.097 ms 1 /classes/stock/StockAvailable.php:453
509 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 1615) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.097 ms 1 /classes/stock/StockAvailable.php:453
540 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1588
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.097 ms 0 /classes/SpecificPrice.php:256
649 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1476
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.097 ms 1 /classes/SpecificPrice.php:256
69 
SELECT SQL_NO_CACHE *
FROM `prstshp_state` a
WHERE (a.`id_state` = 362) LIMIT 1
 0.097 ms 1 /src/Adapter/EntityMapper.php:71
70 
SELECT SQL_NO_CACHE id_required_field, object_name, field_name
FROM prstshp_required_field
 0.096 ms 1 /classes/ObjectModel.php:1592
345 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.096 ms 1 /classes/Product.php:5670
363 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 2344 AND id_shop=1 LIMIT 1
 0.096 ms 1 /classes/Product.php:6884
68 
SELECT SQL_NO_CACHE *
FROM `prstshp_country_lang`
WHERE `id_country` = 6
 0.095 ms 2 /src/Adapter/EntityMapper.php:79
82 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.095 ms 1 /classes/Product.php:5670
88 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE `to` BETWEEN '2026-04-13 00:00:00' AND '2026-04-13 23:59:59' LIMIT 1
 0.095 ms 1 /classes/SpecificPrice.php:381
136 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 2287 AND id_shop=1 LIMIT 1
 0.095 ms 1 /classes/Product.php:6884
287 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 2321 LIMIT 1
 0.095 ms 1 /classes/SpecificPrice.php:435
549 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.095 ms 1 /classes/Product.php:5670
604 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1492 AND id_shop=1 LIMIT 1
 0.095 ms 1 /classes/Product.php:6884
610 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 14 LIMIT 1
 0.095 ms 1 /classes/Product.php:5670
452 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.094 ms 1 /classes/Product.php:5670
697 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 1627
 0.094 ms 1 /classes/Product.php:2899
762 
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module` WHERE `name` = "ps_currencyselector" LIMIT 1
 0.094 ms 1 /classes/module/Module.php:2664
798 
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module_shop` WHERE `id_module` = 70 AND `id_shop` = 1 LIMIT 1
 0.094 ms 1 /classes/module/Module.php:2137
133 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 2287
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.093 ms 1 /classes/SpecificPrice.php:256
150 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 2295) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.093 ms 1 /classes/stock/StockAvailable.php:453
281 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 2318) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.093 ms 1 /classes/stock/StockAvailable.php:453
339 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 2336 AND id_shop=1 LIMIT 1
 0.093 ms 1 /classes/Product.php:6884
399 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1672 AND `id_group` = 1 LIMIT 1
 0.093 ms 0 /classes/GroupReduction.php:153
576 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1574
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.093 ms 0 /classes/SpecificPrice.php:256
700 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 1625
 0.093 ms 1 /classes/Product.php:2899
721 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 1584
 0.093 ms 1 /classes/Product.php:2899
30 
SELECT SQL_NO_CACHE `id_lang` FROM `prstshp_lang`
WHERE `locale` = 'es-es'
OR `language_code` = 'es-es' LIMIT 1
 0.092 ms 2 /classes/Language.php:880
142 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.092 ms 1 /classes/Product.php:5670
185 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 2298 AND `id_group` = 1 LIMIT 1
 0.092 ms 0 /classes/GroupReduction.php:153
232 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 2309 AND id_shop=1 LIMIT 1
 0.092 ms 1 /classes/Product.php:6884
252 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 2315 LIMIT 1
 0.092 ms 1 /classes/SpecificPrice.php:435
256 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 2315 AND id_shop=1 LIMIT 1
 0.092 ms 1 /classes/Product.php:6884
275 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 2318 LIMIT 1
 0.092 ms 1 /classes/SpecificPrice.php:435
454 
SELECT SQL_NO_CACHE `name`
FROM `prstshp_manufacturer`
WHERE `id_manufacturer` = 17
AND `active` = 1 LIMIT 1
 0.092 ms 0 /classes/Manufacturer.php:312
65 
SELECT SQL_NO_CACHE format
FROM `prstshp_address_format`
WHERE `id_country` = 6 LIMIT 1
 0.091 ms 1 /classes/AddressFormat.php:653
375 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 2347 AND id_shop=1 LIMIT 1
 0.091 ms 1 /classes/Product.php:6884
411 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1664 AND `id_group` = 1 LIMIT 1
 0.091 ms 0 /classes/GroupReduction.php:153
585 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `prstshp_category_lang` cl
WHERE `id_lang` = 2
AND cl.id_shop = 1 
AND cl.`id_category` = 47 LIMIT 1
 0.091 ms 1 /classes/Category.php:1373
736 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = 1487
 0.091 ms 1 /classes/Product.php:2899
573 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.090 ms 1 /classes/Product.php:5670
162 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 2296) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.090 ms 1 /classes/stock/StockAvailable.php:453
305 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 2324) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.090 ms 1 /classes/stock/StockAvailable.php:453
423 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1663 AND `id_group` = 1 LIMIT 1
 0.090 ms 0 /classes/GroupReduction.php:153
468 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1625
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.090 ms 0 /classes/SpecificPrice.php:256
501 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.090 ms 1 /classes/Product.php:5670
311 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 2327 LIMIT 1
 0.089 ms 1 /classes/SpecificPrice.php:435
33 
SELECT SQL_NO_CACHE id_shop
FROM `prstshp_currency_shop`
WHERE `id_currency` = 2
AND id_shop = 1 LIMIT 1
 0.089 ms 1 /classes/ObjectModel.php:1727
229 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 2309
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.089 ms 0 /classes/SpecificPrice.php:256
327 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 2328 AND id_shop=1 LIMIT 1
 0.089 ms 1 /classes/Product.php:6884
44 
SELECT SQL_NO_CACHE * FROM `prstshp_image_type`
 0.088 ms 8 /classes/ImageType.php:161
205 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 2303
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.088 ms 0 /classes/SpecificPrice.php:256
519 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1593 AND id_shop=1 LIMIT 1
 0.088 ms 1 /classes/Product.php:6884
531 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1591 AND id_shop=1 LIMIT 1
 0.088 ms 1 /classes/Product.php:6884
537 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.088 ms 1 /classes/Product.php:5670
27 
SELECT SQL_NO_CACHE `id_lang` FROM `prstshp_lang`
WHERE `locale` = 'es-es'
OR `language_code` = 'es-es' LIMIT 1
 0.087 ms 2 /classes/Language.php:880
160 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 2296 AND id_shop=1 LIMIT 1
 0.087 ms 1 /classes/Product.php:6884
265 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 2317 LIMIT 1
 0.087 ms 1 /classes/SpecificPrice.php:435
156 
SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 2296 LIMIT 1
 0.086 ms 1 /classes/SpecificPrice.php:435
181 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 2298
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.086 ms 0 /classes/SpecificPrice.php:256
324 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 2328
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.086 ms 0 /classes/SpecificPrice.php:256
525 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.086 ms 1 /classes/Product.php:5670
465 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.086 ms 1 /classes/Product.php:5670
66 
SELECT SQL_NO_CACHE `need_identification_number`
FROM `prstshp_country`
WHERE `id_country` = 6 LIMIT 1
 0.085 ms 1 /classes/Country.php:402
532 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1591 AND `id_group` = 1 LIMIT 1
 0.085 ms 0 /classes/GroupReduction.php:153
193 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 2301
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.085 ms 0 /classes/SpecificPrice.php:256
273 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.085 ms 1 /classes/Product.php:5670
435 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1661 AND `id_group` = 1 LIMIT 1
 0.085 ms 0 /classes/GroupReduction.php:153
758 
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module_shop` WHERE `id_module` = 77 AND `id_shop` = 1 LIMIT 1
 0.085 ms 1 /classes/module/Module.php:2137
226 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.084 ms 1 /classes/Product.php:5670
244 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 2313 AND id_shop=1 LIMIT 1
 0.084 ms 1 /classes/Product.php:6884
303 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 2324 AND id_shop=1 LIMIT 1
 0.084 ms 1 /classes/Product.php:6884
351 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 2340 AND id_shop=1 LIMIT 1
 0.084 ms 1 /classes/Product.php:6884
489 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.084 ms 1 /classes/Product.php:5670
121 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 2286
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.083 ms 0 /classes/SpecificPrice.php:256
238 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.083 ms 1 /classes/Product.php:5670
369 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.083 ms 1 /classes/Product.php:5670
543 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1588 AND id_shop=1 LIMIT 1
 0.083 ms 1 /classes/Product.php:6884
561 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.083 ms 1 /classes/Product.php:5670
148 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 2295 AND id_shop=1 LIMIT 1
 0.082 ms 1 /classes/Product.php:6884
217 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 2304
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.082 ms 0 /classes/SpecificPrice.php:256
300 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 2324
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.082 ms 0 /classes/SpecificPrice.php:256
321 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.082 ms 1 /classes/Product.php:5670
446 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1660 AND id_shop=1 LIMIT 1
 0.082 ms 1 /classes/Product.php:6884
309 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.081 ms 1 /classes/Product.php:5670
317 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 2327) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.081 ms 1 /classes/stock/StockAvailable.php:453
471 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1625 AND id_shop=1 LIMIT 1
 0.081 ms 1 /classes/Product.php:6884
567 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1579 AND id_shop=1 LIMIT 1
 0.081 ms 1 /classes/Product.php:6884
262 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `prstshp_category_lang` cl
WHERE `id_lang` = 2
AND cl.id_shop = 1 
AND cl.`id_category` = 14 LIMIT 1
 0.081 ms 1 /classes/Category.php:1373
556 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1584 AND `id_group` = 1 LIMIT 1
 0.081 ms 0 /classes/GroupReduction.php:153
665 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1473 AND `id_group` = 1 LIMIT 1
 0.081 ms 0 /classes/GroupReduction.php:153
166 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.080 ms 1 /classes/Product.php:5670
333 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.080 ms 1 /classes/Product.php:5670
483 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1623 AND id_shop=1 LIMIT 1
 0.080 ms 1 /classes/Product.php:6884
507 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1615 AND id_shop=1 LIMIT 1
 0.080 ms 1 /classes/Product.php:6884
579 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1574 AND id_shop=1 LIMIT 1
 0.080 ms 1 /classes/Product.php:6884
761 
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module_shop` WHERE `id_module` = 27 AND `id_shop` = 1 LIMIT 1
 0.080 ms 1 /classes/module/Module.php:2137
495 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 1618 AND id_shop=1 LIMIT 1
 0.080 ms 1 /classes/Product.php:6884
197 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 2301 AND `id_group` = 1 LIMIT 1
 0.079 ms 0 /classes/GroupReduction.php:153
357 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.079 ms 1 /classes/Product.php:5670
169 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 2297
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.078 ms 0 /classes/SpecificPrice.php:256
241 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 2313
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.078 ms 1 /classes/SpecificPrice.php:256
245 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 2313 AND `id_group` = 1 LIMIT 1
 0.078 ms 0 /classes/GroupReduction.php:153
267 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 2317 AND id_shop=1 LIMIT 1
 0.078 ms 1 /classes/Product.php:6884
315 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 2327 AND id_shop=1 LIMIT 1
 0.078 ms 1 /classes/Product.php:6884
340 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 2336 AND `id_group` = 1 LIMIT 1
 0.078 ms 0 /classes/GroupReduction.php:153
154 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.077 ms 1 /classes/Product.php:5670
221 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 2304 AND `id_group` = 1 LIMIT 1
 0.077 ms 0 /classes/GroupReduction.php:153
293 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = 2321) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.077 ms 1 /classes/stock/StockAvailable.php:453
364 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 2344 AND `id_group` = 1 LIMIT 1
 0.077 ms 0 /classes/GroupReduction.php:153
763 
SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module_shop` WHERE `id_module` = 17 AND `id_shop` = 1 LIMIT 1
 0.077 ms 1 /classes/module/Module.php:2137
89 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 2284
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.076 ms 0 /classes/SpecificPrice.php:256
99 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_group`
WHERE `id_group` = 1 LIMIT 1
 0.076 ms 1 /classes/Group.php:151
125 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 2286 AND `id_group` = 1 LIMIT 1
 0.076 ms 0 /classes/GroupReduction.php:153
586 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 47 LIMIT 1
 0.076 ms 1 /classes/Product.php:5670
173 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 2297 AND `id_group` = 1 LIMIT 1
 0.075 ms 0 /classes/GroupReduction.php:153
209 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 2303 AND `id_group` = 1 LIMIT 1
 0.075 ms 0 /classes/GroupReduction.php:153
336 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 2336
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.075 ms 0 /classes/SpecificPrice.php:256
348 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 2340
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.075 ms 0 /classes/SpecificPrice.php:256
605 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1492 AND `id_group` = 1 LIMIT 1
 0.075 ms 0 /classes/GroupReduction.php:153
285 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.074 ms 1 /classes/Product.php:5670
297 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 18 LIMIT 1
 0.074 ms 1 /classes/Product.php:5670
544 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1588 AND `id_group` = 1 LIMIT 1
 0.074 ms 0 /classes/GroupReduction.php:153
617 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1487 AND `id_group` = 1 LIMIT 1
 0.074 ms 0 /classes/GroupReduction.php:153
496 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1618 AND `id_group` = 1 LIMIT 1
 0.073 ms 0 /classes/GroupReduction.php:153
480 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1623
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.072 ms 0 /classes/SpecificPrice.php:256
145 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 2295
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.071 ms 0 /classes/SpecificPrice.php:256
552 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1584
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.071 ms 0 /classes/SpecificPrice.php:256
564 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1579
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.071 ms 0 /classes/SpecificPrice.php:256
528 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1591
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.071 ms 0 /classes/SpecificPrice.php:256
280 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 2318 AND `id_group` = 1 LIMIT 1
 0.070 ms 0 /classes/GroupReduction.php:153
492 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1618
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.070 ms 0 /classes/SpecificPrice.php:256
257 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 2315 AND `id_group` = 1 LIMIT 1
 0.070 ms 0 /classes/GroupReduction.php:153
291 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = 2321 AND id_shop=1 LIMIT 1
 0.070 ms 1 /classes/Product.php:6884
504 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1615
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.070 ms 0 /classes/SpecificPrice.php:256
113 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 2285 AND `id_group` = 1 LIMIT 1
 0.069 ms 0 /classes/GroupReduction.php:153
137 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 2287 AND `id_group` = 1 LIMIT 1
 0.069 ms 0 /classes/GroupReduction.php:153
304 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 2324 AND `id_group` = 1 LIMIT 1
 0.069 ms 0 /classes/GroupReduction.php:153
312 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 2327
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.069 ms 0 /classes/SpecificPrice.php:256
516 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 1593
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.069 ms 0 /classes/SpecificPrice.php:256
149 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 2295 AND `id_group` = 1 LIMIT 1
 0.068 ms 0 /classes/GroupReduction.php:153
161 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 2296 AND `id_group` = 1 LIMIT 1
 0.068 ms 0 /classes/GroupReduction.php:153
233 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 2309 AND `id_group` = 1 LIMIT 1
 0.068 ms 0 /classes/GroupReduction.php:153
263 
SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 2 AND id_category = 14 LIMIT 1
 0.068 ms 1 /classes/Product.php:5670
328 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 2328 AND `id_group` = 1 LIMIT 1
 0.068 ms 0 /classes/GroupReduction.php:153
568 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1579 AND `id_group` = 1 LIMIT 1
 0.068 ms 0 /classes/GroupReduction.php:153
253 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 2315
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.067 ms 0 /classes/SpecificPrice.php:256
276 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 2318
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.067 ms 0 /classes/SpecificPrice.php:256
352 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 2340 AND `id_group` = 1 LIMIT 1
 0.067 ms 0 /classes/GroupReduction.php:153
376 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 2347 AND `id_group` = 1 LIMIT 1
 0.067 ms 0 /classes/GroupReduction.php:153
472 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1625 AND `id_group` = 1 LIMIT 1
 0.067 ms 0 /classes/GroupReduction.php:153
484 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1623 AND `id_group` = 1 LIMIT 1
 0.067 ms 0 /classes/GroupReduction.php:153
288 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 2321
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.066 ms 0 /classes/SpecificPrice.php:256
580 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1574 AND `id_group` = 1 LIMIT 1
 0.066 ms 0 /classes/GroupReduction.php:153
268 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 2317 AND `id_group` = 1 LIMIT 1
 0.065 ms 0 /classes/GroupReduction.php:153
360 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 2344
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.065 ms 0 /classes/SpecificPrice.php:256
508 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 1615 AND `id_group` = 1 LIMIT 1
 0.065 ms 0 /classes/GroupReduction.php:153
157 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `prstshp_specific_price_priority`
WHERE `id_product` = 2296
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.062 ms 0 /classes/SpecificPrice.php:256
316 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 2327 AND `id_group` = 1 LIMIT 1
 0.060 ms 0 /classes/GroupReduction.php:153
292 
SELECT SQL_NO_CACHE `reduction`
FROM `prstshp_product_group_reduction_cache`
WHERE `id_product` = 2321 AND `id_group` = 1 LIMIT 1
 0.053 ms 0 /classes/GroupReduction.php:153

Doubles

49 queries 
SELECT XX FROM `prstshp_specific_price` WHERE id_product = XX LIMIT XX
48 queries 
SELECT image_shop.`id_image`
                    FROM `prstshp_image` i
                     INNER JOIN prstshp_image_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
                    WHERE i.`id_product` = XX
                    AND image_shop.`cover` = XX LIMIT XX
48 queries 
SELECT name FROM prstshp_category_lang WHERE id_shop = XX AND id_lang = XX AND id_category = XX LIMIT XX
48 queries 
SELECT *
FROM `prstshp_product` a
LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = XX
LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = XX
WHERE (a.`id_product` = XX) AND (b.`id_shop` = XX) LIMIT XX
48 queries 
SELECT product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,XX) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `prstshp_product` p
INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = XX)
LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = XX)
WHERE (p.`id_product` = XX)
48 queries 
                            SELECT `id_tax_rules_group`
                            FROM `prstshp_product_shop`
                            WHERE `id_product` = XX AND id_shop=XX LIMIT XX
48 queries 
			SELECT `reduction`
			FROM `prstshp_product_group_reduction_cache`
			WHERE `id_product` = XX AND `id_group` = XX LIMIT XX
48 queries 
SELECT SUM(quantity)
FROM `prstshp_stock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
48 queries 
SELECT
            COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), XX) as deep_quantity,
            COALESCE(SUM(first_level_quantity), XX) as quantity
          FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, XX as pack_quantity
          FROM `prstshp_cart_product` cp
            WHERE cp.`id_product_attribute` = XX
            
            AND cp.`id_cart` = XX AND cp.`id_product` = XX UNION SELECT XX as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
          FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
            WHERE cp.`id_product_attribute` = XX
            
            AND cp.`id_cart` = XX AND p.`id_product_item` = XX AND (pr.`pack_stock_type` IN (XX,XX) OR (
            pr.`pack_stock_type` = XX
            AND XX = XX
        ))) as q LIMIT XX
48 queries 
                SELECT name, value, pf.id_feature, f.position, fvl.id_feature_value
                FROM prstshp_feature_product pf
                LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = XX)
                LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = XX)
                LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = XX)
                 INNER JOIN prstshp_feature_shop feature_shop
        ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = XX)
                WHERE pf.id_product = XX
                ORDER BY f.position ASC
47 queries 
				SELECT `priority`, `id_specific_price_priority`
				FROM `prstshp_specific_price_priority`
				WHERE `id_product` = XX
				ORDER BY `id_specific_price_priority` DESC LIMIT XX
47 queries 
			SELECT *, ( IF (`id_group` = XX, XX, XX) +  IF (`id_country` = XX, XX, XX) +  IF (`id_currency` = XX, XX, XX) +  IF (`id_shop` = XX, XX, XX) +  IF (`id_customer` = XX, XX, XX)) AS `score`
				FROM `prstshp_specific_price`
				WHERE
                `id_shop` IN (XX, XX) AND
                `id_currency` IN (XX, XX) AND
                `id_country` IN (XX, XX) AND
                `id_group` IN (XX, XX) AND `id_product` = XX AND `id_customer` = XX AND `id_product_attribute` = XX AND `id_cart` = XX  AND (`from` = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' >= `from`) AND (`to` = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' <= `to`)
				AND IF(`from_quantity` > XX, `from_quantity`, XX) <= XX ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT XX
24 queries 
            SELECT image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
            FROM `prstshp_image` i
             INNER JOIN prstshp_image_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
            LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = XX)
            WHERE i.`id_product` = XX
            ORDER BY `position`
24 queries 
SELECT `id_product_attribute`
            FROM `prstshp_product_attribute`
            WHERE `id_product` = XX
24 queries 
            SELECT pai.`id_image`, pai.`id_product_attribute`, il.`legend`
            FROM `prstshp_product_attribute_image` pai
            LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`)
            LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`)
            WHERE pai.`id_product_attribute` IN (XX) AND il.`id_lang` = XX ORDER by i.`position`
24 queries 
SELECT pa.`id_product`, a.`color`, pac.`id_product_attribute`, SUM(IF(stock.`quantity` > XX, XX, XX)) qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
            FROM `prstshp_product_attribute` pa
             INNER JOIN prstshp_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX) LEFT JOIN prstshp_stock_available stock
            ON (stock.id_product = `pa`.id_product AND stock.id_product_attribute = IFNULL(`pa`.id_product_attribute, XX) AND stock.id_shop = XX  AND stock.id_shop_group = XX  )
            JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
            JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
            JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = XX)
            JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
            WHERE pa.`id_product` IN (XX) AND ag.`is_color_group` = XX
            GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
            HAVING qty > XX
            ORDER BY a.`position` ASC;
20 queries 
SELECT *
FROM `prstshp_category` a
LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = XX
LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = XX
WHERE (a.`id_category` = XX) AND (b.`id_shop` = XX) LIMIT XX
8 queries 
SELECT `id_module` FROM `prstshp_module_shop` WHERE `id_module` = XX AND `id_shop` = XX LIMIT XX
4 queries 
SELECT `id_lang` FROM `prstshp_lang`
                    WHERE `locale` = 'es-es'
                    OR `language_code` = 'es-es' LIMIT XX
3 queries 
			SELECT cl.`link_rewrite`
			FROM `prstshp_category_lang` cl
			WHERE `id_lang` = XX
			 AND cl.id_shop = XX 
			AND cl.`id_category` = XX LIMIT XX
3 queries 
				SELECT tr.*
				FROM `prstshp_tax_rule` tr
				JOIN `prstshp_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
				WHERE trg.`active` = XX
				AND tr.`id_country` = XX
				AND tr.`id_tax_rules_group` = XX
				AND tr.`id_state` IN (XX, XX)
				AND ('XX' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
					OR (tr.`zipcode_to` = XX AND tr.`zipcode_from` IN(XX, 'XX')))
				ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
2 queries 
SELECT value FROM `prstshp_configuration` WHERE `name` = "PS_MULTISHOP_FEATURE_ACTIVE" LIMIT XX
2 queries 
SELECT *
FROM `prstshp_currency` a
LEFT JOIN `prstshp_currency_lang` `b` ON a.`id_currency` = b.`id_currency` AND b.`id_lang` = XX
LEFT JOIN `prstshp_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = XX
WHERE (a.`id_currency` = XX) LIMIT XX
2 queries 
		SELECT `id_category`
		FROM `prstshp_category_shop`
		WHERE `id_category` = XX
		AND `id_shop` = XX LIMIT XX
2 queries 
SELECT *
FROM `prstshp_category` aXX
LEFT JOIN `prstshp_category_lang` `aXX` ON (aXX.`id_category` = aXX.`id_category`)
WHERE (aXX.`nleft` < XX) AND (aXX.`nright` > XX) AND (aXX.`id_lang` = XX) AND (aXX.`id_shop` = XX)
ORDER BY aXX.`nleft` asc
2 queries 
				SELECT `name`
				FROM `prstshp_manufacturer`
				WHERE `id_manufacturer` = XX
				AND `active` = XX LIMIT XX
2 queries 
SELECT XX FROM `prstshp_cart_rule` WHERE ((date_to >= "XX-XX-XX XX:XX:XX" AND date_to <= "XX-XX-XX XX:XX:XX") OR (date_from >= "XX-XX-XX XX:XX:XX" AND date_from <= "XX-XX-XX XX:XX:XX") OR (date_from < "XX-XX-XX XX:XX:XX" AND date_to > "XX-XX-XX XX:XX:XX")) AND `id_customer` IN (XX,XX) LIMIT XX

Tables stress

148 product
148 product_shop
99 specific_price
98 cart_product
96 image
78 category_lang
75 stock_available
73 product_attribute_shop
73 image_shop
50 product_lang
49 image_lang
49 product_attribute
48 product_group_reduction_cache
48 pack
48 feature_product
48 feature_lang
48 feature_value_lang
48 feature
48 feature_shop
47 specific_price_priority
27 category
25 product_attribute_combination
24 product_attribute_image
24 attribute
24 attribute_lang
24 attribute_group
23 category_shop
13 module
10 module_shop
7 lang
7 hook
7 currency
5 shop_url
5 configuration
5 currency_shop
4 shop
4 lang_shop
3 country
3 hook_alias
3 currency_lang
3 category_group
3 image_type
3 manufacturer
3 tax_rule
3 tax_rules_group
2 shop_group
2 configuration_lang
2 country_lang
2 country_shop
2 hook_module
2 group
2 group_shop
2 category_product
2 cart_rule
2 psgdpr_consent
1 module_group
1 meta
1 meta_lang
1 hook_module_exceptions
1 group_lang
1 feature_flag
1 address_format
1 state
1 required_field
1 tax
1 tax_lang
1 layered_category
1 product_sale
1 layered_filter_block
1 iqit_elementor_category
1 corewhatsapp
1 psgdpr_consent_lang
1 connections
1 page_type
1 page

ObjectModel instances

Name Instances Source
Product 96 /classes/Link.php:113 (__construct) [id: 2284]
/classes/Link.php:113 (__construct) [id: 2285]
/classes/Link.php:113 (__construct) [id: 2286]
/classes/Link.php:113 (__construct) [id: 2287]
/classes/Link.php:113 (__construct) [id: 2295]
/classes/Link.php:113 (__construct) [id: 2296]
/classes/Link.php:113 (__construct) [id: 2297]
/classes/Link.php:113 (__construct) [id: 2298]
/classes/Link.php:113 (__construct) [id: 2301]
/classes/Link.php:113 (__construct) [id: 2303]
/classes/Link.php:113 (__construct) [id: 2304]
/classes/Link.php:113 (__construct) [id: 2309]
/classes/Link.php:113 (__construct) [id: 2313]
/classes/Link.php:113 (__construct) [id: 2315]
/classes/Link.php:113 (__construct) [id: 2317]
/classes/Link.php:113 (__construct) [id: 2318]
/classes/Link.php:113 (__construct) [id: 2321]
/classes/Link.php:113 (__construct) [id: 2324]
/classes/Link.php:113 (__construct) [id: 2327]
/classes/Link.php:113 (__construct) [id: 2328]
/classes/Link.php:113 (__construct) [id: 2336]
/classes/Link.php:113 (__construct) [id: 2340]
/classes/Link.php:113 (__construct) [id: 2344]
/classes/Link.php:113 (__construct) [id: 2347]
/classes/Link.php:113 (__construct) [id: 1672]
/classes/Link.php:113 (__construct) [id: 1664]
/classes/Link.php:113 (__construct) [id: 1663]
/classes/Link.php:113 (__construct) [id: 1661]
/classes/Link.php:113 (__construct) [id: 1660]
/classes/Link.php:113 (__construct) [id: 1627]
/classes/Link.php:113 (__construct) [id: 1625]
/classes/Link.php:113 (__construct) [id: 1623]
/classes/Link.php:113 (__construct) [id: 1618]
/classes/Link.php:113 (__construct) [id: 1615]
/classes/Link.php:113 (__construct) [id: 1593]
/classes/Link.php:113 (__construct) [id: 1591]
/classes/Link.php:113 (__construct) [id: 1588]
/classes/Link.php:113 (__construct) [id: 1584]
/classes/Link.php:113 (__construct) [id: 1579]
/classes/Link.php:113 (__construct) [id: 1574]
/classes/Link.php:113 (__construct) [id: 1512]
/classes/Link.php:113 (__construct) [id: 1492]
/classes/Link.php:113 (__construct) [id: 1487]
/classes/Link.php:113 (__construct) [id: 1485]
/classes/Link.php:113 (__construct) [id: 1477]
/classes/Link.php:113 (__construct) [id: 1476]
/classes/Link.php:113 (__construct) [id: 1473]
/classes/Link.php:113 (__construct) [id: 1472]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1672]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1664]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1663]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1661]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1660]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1627]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1625]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1623]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1618]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1615]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1593]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1591]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1588]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1584]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1579]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1574]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1512]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1492]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1487]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1485]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1477]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1476]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1473]
/src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1472]
/classes/Link.php:113 (__construct) [id: 1672]
/classes/Link.php:113 (__construct) [id: 1664]
/classes/Link.php:113 (__construct) [id: 1663]
/classes/Link.php:113 (__construct) [id: 1661]
/classes/Link.php:113 (__construct) [id: 1660]
/classes/Link.php:113 (__construct) [id: 1627]
/classes/Link.php:113 (__construct) [id: 1625]
/classes/Link.php:113 (__construct) [id: 1623]
/classes/Link.php:113 (__construct) [id: 1618]
/classes/Link.php:113 (__construct) [id: 1615]
/classes/Link.php:113 (__construct) [id: 1593]
/classes/Link.php:113 (__construct) [id: 1591]
/classes/Link.php:113 (__construct) [id: 1588]
/classes/Link.php:113 (__construct) [id: 1584]
/classes/Link.php:113 (__construct) [id: 1579]
/classes/Link.php:113 (__construct) [id: 1574]
/classes/Link.php:113 (__construct) [id: 1512]
/classes/Link.php:113 (__construct) [id: 1492]
/classes/Link.php:113 (__construct) [id: 1487]
/classes/Link.php:113 (__construct) [id: 1485]
/classes/Link.php:113 (__construct) [id: 1477]
/classes/Link.php:113 (__construct) [id: 1476]
/classes/Link.php:113 (__construct) [id: 1473]
/classes/Link.php:113 (__construct) [id: 1472]
Category 24 /controllers/front/listing/CategoryController.php:76 (__construct) [id: 2]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 96]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 14]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 15]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 16]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 17]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 18]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 70]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 59]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 68]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 79]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 86]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 87]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 93]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 112]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 122]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 113]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 115]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 117]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 124]
/classes/Meta.php:379 (__construct) [id: 2]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/classes/Link.php:402 (__construct) [id: 2]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
Country 4 /config/config.inc.php:146 (__construct) [id: 6]
/classes/controller/FrontController.php:354 (__construct) [id: 6]
/classes/AddressFormat.php:404 (__construct) [id: 6]
/classes/controller/FrontController.php:1769 (__construct) [id: 6]
Address 4 /classes/shop/Shop.php:486 (__construct) [id: ]
/classes/Product.php:3694 (initialize) [id: ]
/classes/Product.php:3804 (__construct) [id: ]
/classes/Product.php:5975 (__construct) [id: ]
Currency 3 /src/Adapter/Currency/CurrencyDataProvider.php:101 (__construct) [id: 2]
/src/Adapter/Currency/CurrencyDataProvider.php:101 (__construct) [id: 1]
/classes/Tools.php:696 (getCurrencyInstance) [id: 2]
State 2 /classes/AddressFormat.php:404 (__construct) [id: 362]
/classes/controller/FrontController.php:1768 (__construct) [id: 362]
Language 2 /config/config.inc.php:211 (__construct) [id: 2]
/classes/Tools.php:561 (__construct) [id: 2]
Cart 2 /classes/controller/FrontController.php:467 (__construct) [id: ]
/classes/controller/FrontController.php:541 (__construct) [id: ]
Tax 2 /classes/tax/TaxRulesTaxManager.php:116 (__construct) [id: 53]
/classes/tax/TaxRulesTaxManager.php:116 (__construct) [id: 53]
Shop 1 /config/config.inc.php:117 (initialize) [id: 1]
Connection 1 /modules/statsdata/statsdata.php:118 (setPageConnection) [id: ]
Guest 1 /modules/statsdata/statsdata.php:82 (setNewGuest) [id: ]
IqitElementorCategory 1 /modules/iqitelementor/iqitelementor.php:784 (isJustElementor) [id: ]
Risk 1 /classes/controller/FrontController.php:1695 (__construct) [id: ]
Configuration 1 /modules/ps_accounts/src/Adapter/Configuration.php:239 (__construct) [id: 1315]
AddressFormat 1 /classes/controller/FrontController.php:1763 (generateAddress) [id: ]
Gender 1 /classes/controller/FrontController.php:1692 (__construct) [id: 0]
Group 1 /classes/Cart.php:249 (getCurrent) [id: 1]
Customer 1 /config/config.inc.php:264 (__construct) [id: ]
ShopGroup 1 /classes/shop/Shop.php:561 (__construct) [id: 1]
ConnectionsSource 1 /modules/statsdata/statsdata.php:119 (logHttpReferer) [id: ]

Included Files

# Filename
0 /index.php
1 /config/config.inc.php
2 /config/defines.inc.php
3 /config/autoload.php
4 /vendor/autoload.php
5 /vendor/composer/autoload_real.php
6 /vendor/composer/platform_check.php
7 /vendor/composer/ClassLoader.php
8 /vendor/composer/include_paths.php
9 /vendor/composer/autoload_static.php
10 /vendor/symfony/polyfill-php72/bootstrap.php
11 /vendor/symfony/polyfill-mbstring/bootstrap.php
12 /vendor/symfony/polyfill-mbstring/bootstrap80.php
13 /vendor/symfony/polyfill-intl-normalizer/bootstrap.php
14 /vendor/symfony/polyfill-intl-normalizer/bootstrap80.php
15 /vendor/symfony/polyfill-intl-idn/bootstrap.php
16 /vendor/symfony/deprecation-contracts/function.php
17 /vendor/ralouphie/getallheaders/src/getallheaders.php
18 /vendor/symfony/polyfill-ctype/bootstrap.php
19 /vendor/symfony/polyfill-ctype/bootstrap80.php
20 /vendor/symfony/polyfill-php80/bootstrap.php
21 /vendor/guzzlehttp/promises/src/functions_include.php
22 /vendor/guzzlehttp/promises/src/functions.php
23 /vendor/guzzlehttp/guzzle/src/functions_include.php
24 /vendor/guzzlehttp/guzzle/src/functions.php
25 /vendor/symfony/polyfill-iconv/bootstrap.php
26 /vendor/ezyang/htmlpurifier/library/HTMLPurifier.composer.php
27 /vendor/jakeasmith/http_build_url/src/http_build_url.php
28 /vendor/lcobucci/jwt/compat/class-aliases.php
29 /vendor/lcobucci/jwt/src/Token.php
30 /vendor/lcobucci/jwt/src/Signature.php
31 /vendor/lcobucci/jwt/compat/json-exception-polyfill.php
32 /vendor/lcobucci/jwt/compat/lcobucci-clock-polyfill.php
33 /vendor/swiftmailer/swiftmailer/lib/swift_required.php
34 /vendor/swiftmailer/swiftmailer/lib/classes/Swift.php
35 /vendor/symfony/polyfill-intl-icu/bootstrap.php
36 /vendor/symfony/polyfill-php73/bootstrap.php
37 /vendor/symfony/polyfill-php81/bootstrap.php
38 /vendor/api-platform/core/src/deprecation.php
39 /vendor/api-platform/core/src/Api/FilterInterface.php
40 /vendor/api-platform/core/src/Api/ResourceClassResolverInterface.php
41 /vendor/api-platform/core/src/deprecated_interfaces.php
42 /vendor/api-platform/core/src/Metadata/Property/Factory/PropertyNameCollectionFactoryInterface.php
43 /vendor/api-platform/core/src/Metadata/Resource/Factory/ResourceNameCollectionFactoryInterface.php
44 /vendor/api-platform/core/src/Metadata/Extractor/ResourceExtractorInterface.php
45 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/DateFilterInterface.php
46 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/ExistsFilterInterface.php
47 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/OrderFilterInterface.php
48 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/RangeFilterInterface.php
49 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/SearchFilterInterface.php
50 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationCollectionExtensionInterface.php
51 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationItemExtensionInterface.php
52 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultCollectionExtensionInterface.php
53 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultItemExtensionInterface.php
54 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Filter/FilterInterface.php
55 /vendor/api-platform/core/src/Doctrine/Orm/QueryAwareInterface.php
56 /vendor/api-platform/core/src/Doctrine/Orm/Util/QueryNameGeneratorInterface.php
57 /vendor/api-platform/core/src/Elasticsearch/Metadata/Document/Factory/DocumentMetadataFactoryInterface.php
58 /vendor/api-platform/core/src/Symfony/Validator/ValidationGroupsGeneratorInterface.php
59 /vendor/api-platform/core/src/Symfony/Validator/Exception/ConstraintViolationListAwareExceptionInterface.php
60 /vendor/api-platform/core/src/Exception/ExceptionInterface.php
61 /vendor/api-platform/core/src/Core/Bridge/Symfony/Validator/Metadata/Property/Restriction/PropertySchemaRestrictionMetadataInterface.php
62 /vendor/api-platform/core/src/State/Pagination/PaginatorInterface.php
63 /vendor/api-platform/core/src/State/Pagination/PartialPaginatorInterface.php
64 /vendor/api-platform/core/src/Documentation/DocumentationInterface.php
65 /vendor/api-platform/core/src/JsonLd/AnonymousContextBuilderInterface.php
66 /vendor/api-platform/core/src/JsonLd/ContextBuilderInterface.php
67 /vendor/api-platform/core/src/Core/JsonSchema/SchemaFactoryInterface.php
68 /vendor/api-platform/core/src/JsonSchema/TypeFactoryInterface.php
69 /vendor/api-platform/core/src/OpenApi/Factory/OpenApiFactoryInterface.php
70 /vendor/api-platform/core/src/PathResolver/OperationPathResolverInterface.php
71 /vendor/api-platform/core/src/Symfony/Security/ResourceAccessCheckerInterface.php
72 /vendor/api-platform/core/src/Serializer/Filter/FilterInterface.php
73 /vendor/api-platform/core/src/Serializer/SerializerContextBuilderInterface.php
74 /vendor/api-platform/core/src/Validator/ValidatorInterface.php
75 /vendor/api-platform/core/src/Api/UrlGeneratorInterface.php
76 /vendor/api-platform/core/src/GraphQl/ExecutorInterface.php
77 /vendor/api-platform/core/src/GraphQl/Error/ErrorHandlerInterface.php
78 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ValidateStageInterface.php
79 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ReadStageInterface.php
80 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityPostDenormalizeStageInterface.php
81 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityStageInterface.php
82 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/WriteStageInterface.php
83 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SerializeStageInterface.php
84 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/DeserializeStageInterface.php
85 /vendor/api-platform/core/src/GraphQl/Resolver/QueryItemResolverInterface.php
86 /vendor/api-platform/core/src/GraphQl/Resolver/QueryCollectionResolverInterface.php
87 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Factory/ResolverFactoryInterface.php
88 /vendor/api-platform/core/src/GraphQl/Resolver/MutationResolverInterface.php
89 /vendor/api-platform/core/src/Core/GraphQl/Subscription/MercureSubscriptionIriGeneratorInterface.php
90 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionIdentifierGeneratorInterface.php
91 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionManagerInterface.php
92 /vendor/api-platform/core/src/Core/GraphQl/Serializer/SerializerContextBuilderInterface.php
93 /vendor/api-platform/core/src/GraphQl/Type/TypesFactoryInterface.php
94 /vendor/api-platform/core/src/GraphQl/Type/Definition/TypeInterface.php
95 /vendor/api-platform/core/src/GraphQl/Type/TypesContainerInterface.php
96 /vendor/psr/container/src/ContainerInterface.php
97 /vendor/api-platform/core/src/Operation/PathSegmentNameGeneratorInterface.php
98 /vendor/ircmaxell/password-compat/lib/password.php
99 /vendor/martinlindhe/php-mb-helpers/src/mb_helpers.php
100 /vendor/prestashop/laminas-code-lts/polyfill/ReflectionEnumPolyfill.php
101 /src/Core/Version.php
102 /config/alias.php
103 /vendor/prestashop/autoload/src/PrestashopAutoload.php
104 /vendor/prestashop/autoload/src/LegacyClassLoader.php
105 /vendor/symfony/symfony/src/Symfony/Component/Filesystem/Filesystem.php
106 /vendor/prestashop/autoload/src/Autoloader.php
107 /config/bootstrap.php
108 /src/Core/ContainerBuilder.php
109 /src/Core/Foundation/IoC/Container.php
110 /src/Adapter/ServiceLocator.php
111 /var/cache/prod/appParameters.php
114 /var/cache/prod/class_index.php
115 /classes/controller/Controller.php
117 /classes/ObjectModel.php
118 /src/Core/Foundation/Database/EntityInterface.php
120 /classes/db/Db.php
122 /classes/Hook.php
124 /classes/module/Module.php
125 /src/Core/Module/Legacy/ModuleInterface.php
127 /classes/Tools.php
128 /classes/Context.php
129 /classes/shop/Shop.php
130 /src/Core/Security/PasswordGenerator.php
131 /classes/db/DbPDO.php
132 /classes/AddressFormat.php
133 /classes/Configuration.php
134 /classes/Validate.php
135 /classes/cache/Cache.php
136 /src/Adapter/EntityMapper.php
137 /classes/db/DbQuery.php
138 /src/Core/Addon/Theme/ThemeManagerBuilder.php
139 /vendor/psr/log/Psr/Log/NullLogger.php
140 /vendor/psr/log/Psr/Log/AbstractLogger.php
141 /vendor/psr/log/Psr/Log/LoggerInterface.php
142 /src/Adapter/Configuration.php
143 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ParameterBag.php
144 /src/Core/Domain/Configuration/ShopConfigurationInterface.php
145 /src/Core/ConfigurationInterface.php
146 /src/Core/Addon/Theme/ThemeRepository.php
147 /src/Core/Addon/AddonRepositoryInterface.php
148 /src/Core/Domain/Shop/ValueObject/ShopConstraint.php
149 /src/Core/Addon/Theme/Theme.php
150 /src/Core/Addon/AddonInterface.php
151 /src/Core/Util/ArrayFinder.php
152 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccess.php
153 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorBuilder.php
154 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessor.php
155 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorInterface.php
156 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPath.php
157 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPathInterface.php
158 /config/defines_uri.inc.php
159 /classes/Language.php
160 /src/Core/Language/LanguageInterface.php
161 /classes/Country.php
162 /classes/PrestaShopCollection.php
163 /classes/shop/ShopGroup.php
164 /classes/Cookie.php
165 /classes/PhpEncryption.php
166 /classes/PhpEncryptionEngine.php
167 /vendor/defuse/php-encryption/src/Key.php
168 /vendor/defuse/php-encryption/src/Encoding.php
169 /vendor/defuse/php-encryption/src/Core.php
170 /src/Core/Session/SessionHandler.php
171 /src/Core/Session/SessionHandlerInterface.php
172 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Session.php
173 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBag.php
174 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBagInterface.php
175 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagInterface.php
176 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBag.php
177 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBagInterface.php
178 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagProxy.php
179 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionInterface.php
180 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/PhpBridgeSessionStorage.php
181 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/NativeSessionStorage.php
182 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/MetadataBag.php
183 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/StrictSessionHandler.php
184 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/AbstractSessionHandler.php
185 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/SessionHandlerProxy.php
186 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/AbstractProxy.php
187 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/SessionStorageInterface.php
188 /config/smarty.config.inc.php
189 /vendor/smarty/smarty/libs/Smarty.class.php
190 /vendor/smarty/smarty/libs/functions.php
191 /vendor/smarty/smarty/libs/Autoloader.php
192 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_data.php
193 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_extension_handler.php
194 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php
195 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php
196 /vendor/smarty/smarty/libs/sysplugins/smarty_resource.php
197 /vendor/smarty/smarty/libs/sysplugins/smarty_variable.php
198 /vendor/smarty/smarty/libs/sysplugins/smarty_template_source.php
199 /vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php
200 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_resource_file.php
201 /config/smartyfront.config.inc.php
202 /classes/Smarty/SmartyResourceModule.php
203 /vendor/smarty/smarty/libs/sysplugins/smarty_resource_custom.php
204 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerresource.php
205 /classes/Smarty/SmartyResourceParent.php
206 /classes/Smarty/SmartyLazyRegister.php
207 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerplugin.php
208 /vendor/smarty/smarty/libs/plugins/modifier.truncate.php
209 /classes/Customer.php
210 /classes/Group.php
211 /classes/Link.php
212 /classes/shop/ShopUrl.php
213 /classes/Dispatcher.php
214 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Request.php
215 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeader.php
216 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeaderItem.php
217 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/FileBag.php
218 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderBag.php
219 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderUtils.php
220 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ServerBag.php
221 /src/Adapter/SymfonyContainer.php
222 /vendor/mobiledetect/mobiledetectlib/Mobile_Detect.php
223 /config/db_slave_server.inc.php
224 /src/Adapter/ContainerBuilder.php
225 /src/Adapter/Environment.php
226 /src/Core/EnvironmentInterface.php
227 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCache.php
228 /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerConfigCache.php
229 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheInterface.php
230 /vendor/symfony/symfony/src/Symfony/Component/Cache/DoctrineProvider.php
231 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/CacheProvider.php
232 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Cache.php
233 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/FlushableCache.php
234 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/ClearableCache.php
235 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiOperationCache.php
236 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiGetCache.php
237 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiDeleteCache.php
238 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiPutCache.php
239 /vendor/symfony/symfony/src/Symfony/Component/Cache/PruneableInterface.php
240 /vendor/symfony/symfony/src/Symfony/Component/Cache/ResettableInterface.php
241 /vendor/symfony/contracts/Service/ResetInterface.php
242 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/ArrayAdapter.php
243 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ArrayTrait.php
244 /vendor/psr/log/Psr/Log/LoggerAwareTrait.php
245 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AdapterInterface.php
246 /vendor/symfony/symfony/src/Symfony/Component/Cache/CacheItem.php
247 /vendor/symfony/contracts/Cache/ItemInterface.php
248 /vendor/psr/cache/src/CacheItemInterface.php
249 /vendor/psr/cache/src/CacheItemPoolInterface.php
250 /vendor/symfony/contracts/Cache/CacheInterface.php
251 /vendor/psr/log/Psr/Log/LoggerAwareInterface.php
252 /vendor/doctrine/orm/lib/Doctrine/ORM/Tools/Setup.php
253 /vendor/doctrine/deprecations/lib/Doctrine/Deprecations/Deprecation.php
254 /vendor/doctrine/orm/lib/Doctrine/ORM/Configuration.php
255 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Configuration.php
256 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/CacheAdapter.php
257 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/DoctrineProvider.php
258 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationReader.php
259 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Reader.php
260 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationRegistry.php
261 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/DoctrineAnnotations.php
262 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Annotation.php
263 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Entity.php
264 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embeddable.php
265 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embedded.php
266 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/MappedSuperclass.php
267 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/InheritanceType.php
268 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorColumn.php
269 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorMap.php
270 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Id.php
271 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/GeneratedValue.php
272 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Version.php
273 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumn.php
274 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumns.php
275 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Column.php
276 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToOne.php
277 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToMany.php
278 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToOne.php
279 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToMany.php
280 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Table.php
281 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/UniqueConstraint.php
282 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Index.php
283 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinTable.php
284 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SequenceGenerator.php
285 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/CustomIdGenerator.php
286 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ChangeTrackingPolicy.php
287 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OrderBy.php
288 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQueries.php
289 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQuery.php
290 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/HasLifecycleCallbacks.php
291 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PrePersist.php
292 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostPersist.php
293 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreUpdate.php
294 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostUpdate.php
295 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreRemove.php
296 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostRemove.php
297 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostLoad.php
298 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreFlush.php
299 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/FieldResult.php
300 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ColumnResult.php
301 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityResult.php
302 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQuery.php
303 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQueries.php
304 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMapping.php
305 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMappings.php
306 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverride.php
307 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverrides.php
308 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverride.php
309 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverrides.php
310 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityListeners.php
311 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Cache.php
312 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/SimpleAnnotationReader.php
313 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocParser.php
314 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocLexer.php
315 /vendor/doctrine/lexer/lib/Doctrine/Common/Lexer/AbstractLexer.php
316 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Target.php
317 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/AnnotationDriver.php
318 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/CompatibilityAnnotationDriver.php
319 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/MappingDriver.php
320 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/ColocatedMappingDriver.php
321 /var/cache/prod/FrontContainer.php
322 /src/Adapter/Container/LegacyContainer.php
323 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Container.php
324 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/RewindableGenerator.php
325 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/ServiceLocator.php
326 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ServiceLocator.php
327 /vendor/symfony/contracts/Service/ServiceLocatorTrait.php
328 /vendor/psr/container/src/ContainerExceptionInterface.php
329 /vendor/psr/container/src/NotFoundExceptionInterface.php
330 /vendor/symfony/contracts/Service/ServiceProviderInterface.php
331 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ResettableContainerInterface.php
332 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ContainerInterface.php
333 /src/Adapter/Container/LegacyContainerInterface.php
334 /modules/blockwishlist/vendor/autoload.php
335 /modules/blockwishlist/vendor/composer/autoload_real.php
336 /modules/blockwishlist/vendor/composer/autoload_static.php
337 /modules/contactform/vendor/autoload.php
338 /modules/contactform/vendor/composer/autoload_real.php
339 /modules/contactform/vendor/composer/autoload_static.php
340 /modules/dashactivity/vendor/autoload.php
341 /modules/dashactivity/vendor/composer/autoload_real.php
342 /modules/dashactivity/vendor/composer/autoload_static.php
343 /modules/dashtrends/vendor/autoload.php
344 /modules/dashtrends/vendor/composer/autoload_real.php
345 /modules/dashtrends/vendor/composer/autoload_static.php
346 /modules/dashgoals/vendor/autoload.php
347 /modules/dashgoals/vendor/composer/autoload_real.php
348 /modules/dashgoals/vendor/composer/autoload_static.php
349 /modules/dashproducts/vendor/autoload.php
350 /modules/dashproducts/vendor/composer/autoload_real.php
351 /modules/dashproducts/vendor/composer/platform_check.php
352 /modules/dashproducts/vendor/composer/autoload_static.php
353 /modules/graphnvd3/vendor/autoload.php
354 /modules/graphnvd3/vendor/composer/autoload_real.php
355 /modules/graphnvd3/vendor/composer/autoload_static.php
356 /modules/gridhtml/vendor/autoload.php
357 /modules/gridhtml/vendor/composer/autoload_real.php
358 /modules/gridhtml/vendor/composer/autoload_static.php
359 /modules/gsitemap/vendor/autoload.php
360 /modules/gsitemap/vendor/composer/autoload_real.php
361 /modules/gsitemap/vendor/composer/platform_check.php
362 /modules/gsitemap/vendor/composer/autoload_static.php
363 /modules/pagesnotfound/vendor/autoload.php
364 /modules/pagesnotfound/vendor/composer/autoload_real.php
365 /modules/pagesnotfound/vendor/composer/platform_check.php
366 /modules/pagesnotfound/vendor/composer/autoload_static.php
367 /modules/productcomments/vendor/autoload.php
368 /modules/productcomments/vendor/composer/autoload_real.php
369 /modules/productcomments/vendor/composer/platform_check.php
370 /modules/productcomments/vendor/composer/autoload_static.php
371 /modules/ps_checkpayment/vendor/autoload.php
372 /modules/ps_checkpayment/vendor/composer/autoload_real.php
373 /modules/ps_checkpayment/vendor/composer/autoload_static.php
374 /modules/ps_contactinfo/vendor/autoload.php
375 /modules/ps_contactinfo/vendor/composer/autoload_real.php
376 /modules/ps_contactinfo/vendor/composer/autoload_static.php
377 /modules/ps_crossselling/vendor/autoload.php
378 /modules/ps_crossselling/vendor/composer/autoload_real.php
379 /modules/ps_crossselling/vendor/composer/platform_check.php
380 /modules/ps_crossselling/vendor/composer/autoload_static.php
381 /modules/ps_currencyselector/vendor/autoload.php
382 /modules/ps_currencyselector/vendor/composer/autoload_real.php
383 /modules/ps_currencyselector/vendor/composer/autoload_static.php
384 /modules/ps_customeraccountlinks/vendor/autoload.php
385 /modules/ps_customeraccountlinks/vendor/composer/autoload_real.php
386 /modules/ps_customeraccountlinks/vendor/composer/autoload_static.php
387 /modules/ps_customtext/vendor/autoload.php
388 /modules/ps_customtext/vendor/composer/autoload_real.php
389 /modules/ps_customtext/vendor/composer/platform_check.php
390 /modules/ps_customtext/vendor/composer/autoload_static.php
391 /modules/ps_dataprivacy/vendor/autoload.php
392 /modules/ps_dataprivacy/vendor/composer/autoload_real.php
393 /modules/ps_dataprivacy/vendor/composer/autoload_static.php
394 /modules/ps_emailsubscription/vendor/autoload.php
395 /modules/ps_emailsubscription/vendor/composer/autoload_real.php
396 /modules/ps_emailsubscription/vendor/composer/platform_check.php
397 /modules/ps_emailsubscription/vendor/composer/autoload_static.php
398 /modules/ps_faviconnotificationbo/vendor/autoload.php
399 /modules/ps_faviconnotificationbo/vendor/composer/autoload_real.php
400 /modules/ps_faviconnotificationbo/vendor/composer/platform_check.php
401 /modules/ps_faviconnotificationbo/vendor/composer/autoload_static.php
402 /modules/ps_featuredproducts/vendor/autoload.php
403 /modules/ps_featuredproducts/vendor/composer/autoload_real.php
404 /modules/ps_featuredproducts/vendor/composer/platform_check.php
405 /modules/ps_featuredproducts/vendor/composer/autoload_static.php
406 /modules/ps_imageslider/vendor/autoload.php
407 /modules/ps_imageslider/vendor/composer/autoload_real.php
408 /modules/ps_imageslider/vendor/composer/platform_check.php
409 /modules/ps_imageslider/vendor/composer/autoload_static.php
410 /modules/ps_languageselector/vendor/autoload.php
411 /modules/ps_languageselector/vendor/composer/autoload_real.php
412 /modules/ps_languageselector/vendor/composer/autoload_static.php
413 /modules/ps_linklist/vendor/autoload.php
414 /modules/ps_linklist/vendor/composer/autoload_real.php
415 /modules/ps_linklist/vendor/composer/autoload_static.php
416 /modules/ps_mainmenu/vendor/autoload.php
417 /modules/ps_mainmenu/vendor/composer/autoload_real.php
418 /modules/ps_mainmenu/vendor/composer/platform_check.php
419 /modules/ps_mainmenu/vendor/composer/autoload_static.php
420 /modules/ps_searchbar/vendor/autoload.php
421 /modules/ps_searchbar/vendor/composer/autoload_real.php
422 /modules/ps_searchbar/vendor/composer/autoload_static.php
423 /modules/ps_sharebuttons/vendor/autoload.php
424 /modules/ps_sharebuttons/vendor/composer/autoload_real.php
425 /modules/ps_sharebuttons/vendor/composer/autoload_static.php
426 /modules/ps_shoppingcart/vendor/autoload.php
427 /modules/ps_shoppingcart/vendor/composer/autoload_real.php
428 /modules/ps_shoppingcart/vendor/composer/autoload_static.php
429 /modules/ps_socialfollow/vendor/autoload.php
430 /modules/ps_socialfollow/vendor/composer/autoload_real.php
431 /modules/ps_socialfollow/vendor/composer/platform_check.php
432 /modules/ps_socialfollow/vendor/composer/autoload_static.php
433 /modules/ps_themecusto/vendor/autoload.php
434 /modules/ps_themecusto/vendor/composer/autoload_real.php
435 /modules/ps_themecusto/vendor/composer/autoload_static.php
436 /modules/ps_wirepayment/vendor/autoload.php
437 /modules/ps_wirepayment/vendor/composer/autoload_real.php
438 /modules/ps_wirepayment/vendor/composer/platform_check.php
439 /modules/ps_wirepayment/vendor/composer/autoload_static.php
440 /modules/statsbestcategories/vendor/autoload.php
441 /modules/statsbestcategories/vendor/composer/autoload_real.php
442 /modules/statsbestcategories/vendor/composer/platform_check.php
443 /modules/statsbestcategories/vendor/composer/autoload_static.php
444 /modules/statsbestcustomers/vendor/autoload.php
445 /modules/statsbestcustomers/vendor/composer/autoload_real.php
446 /modules/statsbestcustomers/vendor/composer/platform_check.php
447 /modules/statsbestcustomers/vendor/composer/autoload_static.php
448 /modules/statsbestproducts/vendor/autoload.php
449 /modules/statsbestproducts/vendor/composer/autoload_real.php
450 /modules/statsbestproducts/vendor/composer/platform_check.php
451 /modules/statsbestproducts/vendor/composer/autoload_static.php
452 /modules/statsbestsuppliers/vendor/autoload.php
453 /modules/statsbestsuppliers/vendor/composer/autoload_real.php
454 /modules/statsbestsuppliers/vendor/composer/platform_check.php
455 /modules/statsbestsuppliers/vendor/composer/autoload_static.php
456 /modules/statsbestvouchers/vendor/autoload.php
457 /modules/statsbestvouchers/vendor/composer/autoload_real.php
458 /modules/statsbestvouchers/vendor/composer/platform_check.php
459 /modules/statsbestvouchers/vendor/composer/autoload_static.php
460 /modules/statscarrier/vendor/autoload.php
461 /modules/statscarrier/vendor/composer/autoload_real.php
462 /modules/statscarrier/vendor/composer/platform_check.php
463 /modules/statscarrier/vendor/composer/autoload_static.php
464 /modules/statscatalog/vendor/autoload.php
465 /modules/statscatalog/vendor/composer/autoload_real.php
466 /modules/statscatalog/vendor/composer/platform_check.php
467 /modules/statscatalog/vendor/composer/autoload_static.php
468 /modules/statscheckup/vendor/autoload.php
469 /modules/statscheckup/vendor/composer/autoload_real.php
470 /modules/statscheckup/vendor/composer/platform_check.php
471 /modules/statscheckup/vendor/composer/autoload_static.php
472 /modules/statsdata/vendor/autoload.php
473 /modules/statsdata/vendor/composer/autoload_real.php
474 /modules/statsdata/vendor/composer/platform_check.php
475 /modules/statsdata/vendor/composer/autoload_static.php
476 /modules/statsforecast/vendor/autoload.php
477 /modules/statsforecast/vendor/composer/autoload_real.php
478 /modules/statsforecast/vendor/composer/platform_check.php
479 /modules/statsforecast/vendor/composer/autoload_static.php
480 /modules/statsnewsletter/vendor/autoload.php
481 /modules/statsnewsletter/vendor/composer/autoload_real.php
482 /modules/statsnewsletter/vendor/composer/platform_check.php
483 /modules/statsnewsletter/vendor/composer/autoload_static.php
484 /modules/statspersonalinfos/vendor/autoload.php
485 /modules/statspersonalinfos/vendor/composer/autoload_real.php
486 /modules/statspersonalinfos/vendor/composer/platform_check.php
487 /modules/statspersonalinfos/vendor/composer/autoload_static.php
488 /modules/statsproduct/vendor/autoload.php
489 /modules/statsproduct/vendor/composer/autoload_real.php
490 /modules/statsproduct/vendor/composer/platform_check.php
491 /modules/statsproduct/vendor/composer/autoload_static.php
492 /modules/statsregistrations/vendor/autoload.php
493 /modules/statsregistrations/vendor/composer/autoload_real.php
494 /modules/statsregistrations/vendor/composer/platform_check.php
495 /modules/statsregistrations/vendor/composer/autoload_static.php
496 /modules/statssales/vendor/autoload.php
497 /modules/statssales/vendor/composer/autoload_real.php
498 /modules/statssales/vendor/composer/platform_check.php
499 /modules/statssales/vendor/composer/autoload_static.php
500 /modules/statssearch/vendor/autoload.php
501 /modules/statssearch/vendor/composer/autoload_real.php
502 /modules/statssearch/vendor/composer/platform_check.php
503 /modules/statssearch/vendor/composer/autoload_static.php
504 /modules/statsstock/vendor/autoload.php
505 /modules/statsstock/vendor/composer/autoload_real.php
506 /modules/statsstock/vendor/composer/platform_check.php
507 /modules/statsstock/vendor/composer/autoload_static.php
508 /modules/psgdpr/vendor/autoload.php
509 /modules/psgdpr/vendor/composer/autoload_real.php
510 /modules/psgdpr/vendor/composer/autoload_static.php
511 /modules/ps_metrics/vendor/autoload.php
512 /modules/ps_metrics/vendor/composer/autoload_real.php
513 /modules/ps_metrics/vendor/composer/autoload_static.php
514 /modules/ps_metrics/vendor/symfony/polyfill-php80/bootstrap.php
515 /modules/ps_metrics/vendor/symfony/deprecation-contracts/function.php
516 /modules/ps_metrics/vendor/symfony/polyfill-mbstring/bootstrap.php
517 /modules/ps_metrics/vendor/symfony/polyfill-mbstring/bootstrap80.php
518 /modules/ps_metrics/vendor/symfony/polyfill-ctype/bootstrap.php
519 /modules/ps_metrics/vendor/symfony/polyfill-ctype/bootstrap80.php
520 /modules/ps_metrics/vendor/symfony/polyfill-php73/bootstrap.php
521 /modules/ps_metrics/vendor/symfony/polyfill-intl-grapheme/bootstrap.php
522 /modules/ps_metrics/vendor/symfony/polyfill-intl-normalizer/bootstrap.php
523 /modules/ps_metrics/vendor/symfony/polyfill-intl-normalizer/bootstrap80.php
524 /modules/ps_metrics/vendor/symfony/string/Resources/functions.php
525 /modules/ps_metrics/vendor/clue/stream-filter/src/functions_include.php
526 /modules/ps_metrics/vendor/clue/stream-filter/src/functions.php
527 /modules/ps_metrics/vendor/ralouphie/getallheaders/src/getallheaders.php
528 /modules/ps_metrics/vendor/guzzlehttp/psr7/src/functions_include.php
529 /modules/ps_metrics/vendor/guzzlehttp/psr7/src/functions.php
530 /modules/ps_metrics/vendor/php-http/message/src/filters.php
531 /modules/ps_metrics/vendor/symfony/polyfill-php81/bootstrap.php
532 /modules/ps_metrics/vendor/phpstan/phpstan/bootstrap.php
533 /modules/ps_metrics/vendor/segmentio/analytics-php/lib/Segment.php
534 /modules/ps_metrics/vendor/segmentio/analytics-php/lib/Segment/Client.php
535 /modules/ps_metrics/vendor/segmentio/analytics-php/lib/Segment/Consumer.php
536 /modules/ps_metrics/vendor/segmentio/analytics-php/lib/Segment/QueueConsumer.php
537 /modules/ps_metrics/vendor/segmentio/analytics-php/lib/Segment/Consumer/File.php
538 /modules/ps_metrics/vendor/segmentio/analytics-php/lib/Segment/Consumer/ForkCurl.php
539 /modules/ps_metrics/vendor/segmentio/analytics-php/lib/Segment/Consumer/Socket.php
540 /modules/ps_facebook/vendor/autoload.php
541 /modules/ps_facebook/vendor/composer/autoload_real.php
542 /modules/ps_facebook/vendor/composer/autoload_static.php
543 /modules/ps_facebook/vendor/segmentio/analytics-php/lib/Segment.php
544 /modules/ps_facebook/vendor/segmentio/analytics-php/lib/Segment/Client.php
545 /modules/ps_facebook/vendor/segmentio/analytics-php/lib/Segment/Consumer.php
546 /modules/ps_facebook/vendor/segmentio/analytics-php/lib/Segment/QueueConsumer.php
547 /modules/ps_facebook/vendor/segmentio/analytics-php/lib/Segment/Consumer/File.php
548 /modules/ps_facebook/vendor/segmentio/analytics-php/lib/Segment/Consumer/ForkCurl.php
549 /modules/ps_facebook/vendor/segmentio/analytics-php/lib/Segment/Consumer/LibCurl.php
550 /modules/ps_facebook/vendor/segmentio/analytics-php/lib/Segment/Consumer/Socket.php
551 /modules/ps_facebook/vendor/segmentio/analytics-php/lib/Segment/Version.php
552 /modules/psxmarketingwithgoogle/vendor/autoload.php
553 /modules/psxmarketingwithgoogle/vendor/composer/autoload_real.php
554 /modules/psxmarketingwithgoogle/vendor/composer/autoload_static.php
555 /modules/blockreassurance/vendor/autoload.php
556 /modules/blockreassurance/vendor/composer/autoload_real.php
557 /modules/blockreassurance/vendor/composer/autoload_static.php
558 /modules/ps_facetedsearch/vendor/autoload.php
559 /modules/ps_facetedsearch/vendor/composer/autoload_real.php
560 /modules/ps_facetedsearch/vendor/composer/platform_check.php
561 /modules/ps_facetedsearch/vendor/composer/autoload_static.php
562 /modules/ps_emailalerts/vendor/autoload.php
563 /modules/ps_emailalerts/vendor/composer/autoload_real.php
564 /modules/ps_emailalerts/vendor/composer/autoload_static.php
565 /modules/ps_categorytree/vendor/autoload.php
566 /modules/ps_categorytree/vendor/composer/autoload_real.php
567 /modules/ps_categorytree/vendor/composer/platform_check.php
568 /modules/ps_categorytree/vendor/composer/autoload_static.php
569 /modules/ps_distributionapiclient/vendor/autoload.php
570 /modules/ps_distributionapiclient/vendor/composer/autoload_real.php
571 /modules/ps_distributionapiclient/vendor/composer/platform_check.php
572 /modules/ps_distributionapiclient/vendor/composer/autoload_static.php
573 /modules/ps_distributionapiclient/vendor/symfony/polyfill-intl-grapheme/bootstrap.php
574 /modules/ps_distributionapiclient/vendor/symfony/string/Resources/functions.php
575 /src/Core/Hook/HookModuleFilter.php
576 /src/Core/Hook/HookModuleFilterInterface.php
577 /controllers/front/listing/CategoryController.php
578 /classes/controller/ProductListingFrontController.php
579 /classes/controller/ProductPresentingFrontController.php
580 /classes/controller/FrontController.php
581 /src/PrestaShopBundle/Translation/TranslatorComponent.php
582 /vendor/symfony/symfony/src/Symfony/Component/Translation/Translator.php
583 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorInterface.php
584 /vendor/symfony/contracts/Translation/LocaleAwareInterface.php
585 /vendor/symfony/contracts/Translation/TranslatorInterface.php
586 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorBagInterface.php
587 /src/PrestaShopBundle/Translation/PrestaShopTranslatorTrait.php
588 /src/PrestaShopBundle/Translation/TranslatorLanguageTrait.php
589 /src/PrestaShopBundle/Translation/TranslatorInterface.php
590 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatter.php
591 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatter.php
592 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatterInterface.php
593 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatterInterface.php
594 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/ChoiceMessageFormatterInterface.php
595 /vendor/symfony/symfony/src/Symfony/Component/Translation/IdentityTranslator.php
596 /vendor/symfony/contracts/Translation/TranslatorTrait.php
597 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactory.php
598 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactoryInterface.php
599 /var/cache/prod/translations/catalogue.es-ES.NXhscRe.php
600 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogue.php
601 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogueInterface.php
602 /vendor/symfony/symfony/src/Symfony/Component/Translation/MetadataAwareInterface.php
603 /src/Adapter/Presenter/Object/ObjectPresenter.php
604 /src/Adapter/Presenter/PresenterInterface.php
605 /src/Adapter/Presenter/Cart/CartPresenter.php
606 /src/Adapter/Image/ImageRetriever.php
607 /classes/tax/TaxConfiguration.php
608 /classes/Smarty/TemplateFinder.php
609 /classes/assets/StylesheetManager.php
610 /classes/assets/AbstractAssetManager.php
611 /src/Adapter/Assets/AssetUrlGeneratorTrait.php
612 /classes/assets/JavascriptManager.php
613 /classes/assets/CccReducer.php
614 /modules/iqitthemeeditor/iqitthemeeditor.php
615 /modules/iqitthemeeditor/src/IqitSmartyModifiers.php
616 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_createdata.php
617 /vendor/smarty/smarty/libs/sysplugins/smarty_data.php
618 /classes/Translate.php
619 /modules/iqitthemeeditor/translations/es.php
620 /classes/Category.php
621 /classes/webservice/WebserviceRequest.php
622 /src/Core/Localization/Locale/Repository.php
623 /src/Core/Localization/Locale/RepositoryInterface.php
624 /src/Core/Localization/CLDR/LocaleRepository.php
625 /src/Core/Localization/CLDR/LocaleDataSource.php
626 /src/Core/Localization/CLDR/DataLayer/LocaleCache.php
627 /src/Core/Data/Layer/AbstractDataLayer.php
628 /src/Core/Localization/CLDR/LocaleDataLayerInterface.php
629 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/FilesystemAdapter.php
630 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AbstractAdapter.php
631 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractAdapterTrait.php
632 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractTrait.php
633 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ContractsTrait.php
634 /vendor/symfony/contracts/Cache/CacheTrait.php
635 /vendor/psr/cache/src/InvalidArgumentException.php
636 /vendor/psr/cache/src/CacheException.php
637 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemTrait.php
638 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemCommonTrait.php
639 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/DefaultMarshaller.php
640 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/MarshallerInterface.php
641 /src/Core/Localization/CLDR/DataLayer/LocaleReference.php
642 /src/Core/Localization/CLDR/Reader.php
643 /src/Core/Localization/CLDR/ReaderInterface.php
644 /src/Core/Localization/Currency/Repository.php
645 /src/Core/Localization/Currency/RepositoryInterface.php
646 /src/Core/Localization/Currency/CurrencyDataSource.php
647 /src/Core/Localization/Currency/DataSourceInterface.php
648 /src/Core/Localization/Currency/DataLayer/CurrencyCache.php
649 /src/Core/Localization/Currency/CurrencyDataLayerInterface.php
650 /src/Core/Localization/Currency/DataLayer/CurrencyDatabase.php
651 /src/Adapter/Currency/CurrencyDataProvider.php
652 /src/Core/Currency/CurrencyDataProviderInterface.php
653 /src/Adapter/LegacyContext.php
654 /src/Adapter/Tools.php
655 /src/Core/Localization/Currency/DataLayer/CurrencyReference.php
656 /src/Core/Localization/Currency/DataLayer/CurrencyInstalled.php
657 /vendor/prestashop/decimal/src/Operation/Rounding.php
658 /src/Core/Localization/Locale.php
659 /src/Core/Localization/LocaleInterface.php
660 /src/Core/Localization/Specification/Price.php
661 /src/Core/Localization/Specification/Number.php
662 /src/Core/Localization/Specification/NumberInterface.php
663 /src/Core/Localization/Specification/Factory.php
664 /src/Core/Localization/CLDR/LocaleData.php
665 /src/Core/Localization/CLDR/NumberSymbolsData.php
666 /src/Core/Localization/CLDR/CurrencyData.php
667 /src/Core/Localization/CLDR/Locale.php
668 /src/Core/Localization/CLDR/LocaleInterface.php
669 /src/Core/Localization/Specification/NumberSymbolList.php
670 /classes/Currency.php
671 /src/Core/Localization/Currency/LocalizedCurrencyId.php
672 /src/Core/Localization/Currency/CurrencyData.php
673 /src/Core/Localization/Currency/CurrencyCollection.php
674 /src/Core/Localization/Currency.php
675 /src/Core/Localization/CurrencyInterface.php
676 /src/Core/Localization/Specification/NumberCollection.php
677 /src/Core/Localization/Number/Formatter.php
678 /classes/Cart.php
679 /src/Adapter/AddressFactory.php
680 /classes/CartRule.php
681 /classes/Product.php
682 /src/Core/Domain/Product/ValueObject/RedirectType.php
683 /src/Core/Util/DateTime/DateTime.php
684 /src/Core/Domain/Product/Stock/ValueObject/OutOfStockType.php
685 /src/Core/Domain/Product/Pack/ValueObject/PackStockType.php
686 /src/Core/Domain/Product/ValueObject/ProductType.php
687 /src/Core/Domain/Product/ValueObject/Reference.php
688 /src/Core/Domain/Product/ValueObject/Ean13.php
689 /src/Core/Domain/Product/ValueObject/Isbn.php
690 /src/Core/Domain/Product/ValueObject/Upc.php
691 /src/Core/Domain/Product/ProductSettings.php
692 /src/Core/Image/ImageFormatConfiguration.php
693 /src/Core/Image/ImageFormatConfigurationInterface.php
694 /classes/FeatureFlag.php
695 /src/Core/FeatureFlag/FeatureFlagSettings.php
696 /classes/ImageType.php
697 /src/Core/Domain/Shop/ValueObject/ShopId.php
698 /src/Core/Domain/Shop/ValueObject/ShopIdInterface.php
699 /modules/ps_emailsubscription/ps_emailsubscription.php
700 /src/Core/Module/WidgetInterface.php
701 /src/PrestaShopBundle/Translation/DomainNormalizer.php
702 /classes/Media.php
703 /modules/ps_facebook/ps_facebook.php
704 /modules/ps_facebook/translations/es.php
705 /modules/ps_metrics/vendor/prestashop/module-lib-service-container/src/DependencyInjection/ServiceContainer.php
706 /modules/ps_metrics/vendor/prestashop/module-lib-cache-directory-provider/src/Cache/CacheDirectoryProvider.php
707 /modules/ps_metrics/vendor/prestashop/module-lib-service-container/src/DependencyInjection/ContainerProvider.php
708 /var/cache/prod/Ps_facebookFrontContainer.php
709 /modules/ps_facebook/classes/Buffer/TemplateBuffer.php
710 /modules/ps_emailalerts/ps_emailalerts.php
711 /modules/ps_emailalerts/MailAlert.php
712 /src/Adapter/Presenter/Cart/CartLazyArray.php
713 /src/Adapter/Presenter/AbstractLazyArray.php
714 /src/Adapter/Product/PriceFormatter.php
715 /src/Core/Util/Inflector.php
716 /vendor/doctrine/inflector/lib/Doctrine/Inflector/InflectorFactory.php
717 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Language.php
718 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/InflectorFactory.php
719 /vendor/doctrine/inflector/lib/Doctrine/Inflector/GenericLanguageInflectorFactory.php
720 /vendor/doctrine/inflector/lib/Doctrine/Inflector/LanguageInflectorFactory.php
721 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Rules.php
722 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Ruleset.php
723 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformations.php
724 /vendor/doctrine/inflector/lib/Doctrine/Inflector/WordInflector.php
725 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Inflectible.php
726 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformation.php
727 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Pattern.php
728 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Patterns.php
729 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Uninflected.php
730 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitutions.php
731 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitution.php
732 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Word.php
733 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Inflector.php
734 /vendor/doctrine/inflector/lib/Doctrine/Inflector/CachedWordInflector.php
735 /vendor/doctrine/inflector/lib/Doctrine/Inflector/RulesetInflector.php
736 /classes/Gender.php
737 /classes/Risk.php
738 /classes/Meta.php
739 /classes/Address.php
740 /classes/State.php
741 /src/Core/Security/PasswordPolicyConfiguration.php
742 /src/Core/Configuration/DataConfigurationInterface.php
743 /src/Core/Security/Hashing.php
744 /src/Core/Filter/FrontEndObject/MainFilter.php
745 /src/Core/Filter/FilterInterface.php
746 /src/Core/Filter/FrontEndObject/CartFilter.php
747 /src/Core/Filter/HashMapWhitelistFilter.php
748 /src/Core/Filter/CollectionFilter.php
749 /src/Core/Filter/FrontEndObject/ProductFilter.php
750 /src/Core/Filter/FrontEndObject/EmbeddedAttributesFilter.php
751 /src/Core/Filter/FrontEndObject/CustomerFilter.php
752 /src/Core/Filter/FrontEndObject/ShopFilter.php
753 /src/Core/Filter/FrontEndObject/ConfigurationFilter.php
754 /modules/productcomments/productcomments.php
755 /modules/ps_shoppingcart/ps_shoppingcart.php
756 /modules/ps_facebook/classes/Handler/ErrorHandler/ErrorHandler.php
757 /modules/ps_facebook/classes/Config/Env.php
758 /modules/ps_facebook/classes/Handler/ErrorHandler/ModuleFilteredRavenClient.php
759 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/Client.php
760 /modules/ps_facebook/classes/Config/Config.php
761 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/Util.php
762 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/Compat.php
763 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/Processor/SanitizeDataProcessor.php
764 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/Processor.php
765 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/Context.php
766 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/Breadcrumbs.php
767 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/Serializer.php
768 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/ReprSerializer.php
769 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/TransactionStack.php
770 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/Breadcrumbs/ErrorHandler.php
771 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/Stacktrace.php
772 /modules/ps_facebook/vendor/prestashop/prestashop-accounts-installer/src/Installer/Facade/PsAccounts.php
773 /modules/ps_facebook/vendor/prestashop/prestashop-accounts-installer/src/Installer/Installer.php
774 /src/Core/Addon/Module/ModuleManagerBuilder.php
775 /src/Core/Util/File/YamlParser.php
776 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/SelfCheckingResourceChecker.php
777 /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerInterface.php
778 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/FileResource.php
779 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/SelfCheckingResourceInterface.php
780 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/ResourceInterface.php
781 /var/cache/prod/yaml/b57b1d618dfd4975fcf38dbdde58e4aa.php
782 /src/Adapter/LegacyLogger.php
783 /src/PrestaShopBundle/Service/DataProvider/Admin/CategoriesProvider.php
784 /src/Adapter/Module/ModuleDataProvider.php
785 /src/Adapter/Module/AdminModuleDataProvider.php
786 /src/PrestaShopBundle/Service/DataProvider/Admin/ModuleInterface.php
787 /src/Adapter/Module/Module.php
788 /src/Core/Module/ModuleInterface.php
789 /vendor/symfony/symfony/src/Symfony/Component/Config/FileLocator.php
790 /vendor/symfony/symfony/src/Symfony/Component/Config/FileLocatorInterface.php
791 /vendor/symfony/symfony/src/Symfony/Component/Routing/Loader/YamlFileLoader.php
792 /vendor/symfony/symfony/src/Symfony/Component/Config/Loader/FileLoader.php
793 /vendor/symfony/symfony/src/Symfony/Component/Config/Loader/Loader.php
794 /vendor/symfony/symfony/src/Symfony/Component/Config/Loader/LoaderInterface.php
795 /vendor/symfony/symfony/src/Symfony/Component/Routing/Router.php
796 /vendor/symfony/symfony/src/Symfony/Component/Routing/RouterInterface.php
797 /vendor/symfony/symfony/src/Symfony/Component/Routing/Matcher/UrlMatcherInterface.php
798 /vendor/symfony/symfony/src/Symfony/Component/Routing/RequestContextAwareInterface.php
799 /vendor/symfony/symfony/src/Symfony/Component/Routing/Generator/UrlGeneratorInterface.php
800 /vendor/symfony/symfony/src/Symfony/Component/Routing/Matcher/RequestMatcherInterface.php
801 /vendor/symfony/symfony/src/Symfony/Component/Routing/RequestContext.php
802 /src/Adapter/Module/ModuleDataUpdater.php
803 /src/Core/Module/ModuleManager.php
804 /src/Core/Module/ModuleManagerInterface.php
805 /src/Core/Module/ModuleRepository.php
806 /src/Core/Module/ModuleRepositoryInterface.php
807 /src/Adapter/HookManager.php
808 /src/Core/Module/SourceHandler/SourceHandlerFactory.php
809 /src/PrestaShopBundle/Event/Dispatcher/NullDispatcher.php
810 /vendor/symfony/symfony/src/Symfony/Component/EventDispatcher/EventDispatcherInterface.php
811 /vendor/symfony/contracts/EventDispatcher/EventDispatcherInterface.php
812 /modules/ps_metrics/vendor/psr/event-dispatcher/src/EventDispatcherInterface.php
813 /src/Core/Hook/HookDispatcherInterface.php
814 /modules/ps_accounts/ps_accounts.php
815 /modules/ps_accounts/vendor/autoload.php
816 /modules/ps_accounts/vendor/composer/autoload_real.php
817 /modules/ps_accounts/vendor/composer/platform_check.php
818 /modules/ps_accounts/vendor/composer/autoload_static.php
819 /modules/ps_accounts/vendor/paragonie/random_compat/lib/random.php
820 /modules/ps_accounts/vendor/symfony/polyfill-ctype/bootstrap.php
821 /modules/ps_accounts/vendor/lcobucci/jwt/compat/class-aliases.php
822 /modules/ps_accounts/vendor/lcobucci/jwt/src/Token.php
823 /modules/ps_accounts/vendor/lcobucci/jwt/src/Signature.php
824 /modules/ps_accounts/vendor/lcobucci/jwt/compat/json-exception-polyfill.php
825 /modules/ps_accounts/vendor/lcobucci/jwt/compat/lcobucci-clock-polyfill.php
826 /modules/ps_accounts/vendor/ramsey/uuid/src/functions.php
827 /modules/ps_accounts/src/Hook/HookableTrait.php
828 /modules/ps_accounts/src/Module/Install.php
829 /modules/ps_accounts/src/Settings/SettingsForm.php
830 /modules/ps_accounts/translations/es.php
831 /modules/ps_accounts/src/ServiceContainer/PsAccountsContainer.php
832 /modules/ps_accounts/vendor/prestashopcorp/lightweight-container/src/ServiceContainer/ServiceContainer.php
833 /modules/ps_accounts/config.php
834 /modules/ps_accounts/src/Log/Logger.php
835 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Logger.php
836 /modules/ps_accounts/vendor/psr/log/Psr/Log/LoggerInterface.php
837 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/ResettableInterface.php
838 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Handler/RotatingFileHandler.php
839 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Handler/StreamHandler.php
840 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Handler/AbstractProcessingHandler.php
841 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Handler/AbstractHandler.php
842 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Handler/HandlerInterface.php
843 /modules/ps_accounts/vendor/monolog/monolog/src/Monolog/Utils.php
844 /modules/ps_accounts/src/ServiceProvider/ApiClientProvider.php
845 /modules/ps_accounts/vendor/prestashopcorp/lightweight-container/src/ServiceContainer/Contract/IServiceProvider.php
846 /modules/ps_accounts/src/ServiceProvider/CommandProvider.php
847 /modules/ps_accounts/src/ServiceProvider/DefaultProvider.php
848 /modules/ps_accounts/src/ServiceProvider/OAuth2Provider.php
849 /modules/ps_accounts/src/ServiceProvider/QueryProvider.php
850 /modules/ps_accounts/src/ServiceProvider/RepositoryProvider.php
851 /modules/ps_accounts/src/ServiceProvider/SessionProvider.php
852 /modules/ps_accounts/src/Service/PsAccountsService.php
853 /modules/ps_accounts/src/Account/Session/ShopSession.php
854 /modules/ps_accounts/src/Account/Session/Session.php
855 /modules/ps_accounts/src/Account/Session/SessionInterface.php
856 /modules/ps_accounts/src/Repository/ConfigurationRepository.php
857 /modules/ps_accounts/src/Adapter/Configuration.php
858 /modules/ps_accounts/src/Service/OAuth2/OAuth2Service.php
859 /modules/ps_accounts/src/Http/Client/ClientConfig.php
860 /modules/ps_accounts/src/Http/Client/ConfigObject.php
861 /modules/ps_accounts/src/Type/Enum.php
862 /modules/ps_accounts/src/Service/OAuth2/OAuth2Client.php
863 /modules/ps_accounts/src/Adapter/Link.php
864 /modules/ps_accounts/src/Context/ShopContext.php
865 /modules/ps_accounts/vendor/ramsey/uuid/src/Uuid.php
866 /modules/ps_accounts/vendor/ramsey/uuid/src/UuidInterface.php
867 /modules/ps_accounts/vendor/ramsey/uuid/src/UuidFactory.php
868 /modules/ps_accounts/vendor/ramsey/uuid/src/UuidFactoryInterface.php
869 /modules/ps_accounts/vendor/ramsey/uuid/src/FeatureSet.php
870 /modules/ps_accounts/vendor/ramsey/uuid/src/Converter/Number/DegradedNumberConverter.php
871 /modules/ps_accounts/vendor/ramsey/uuid/src/Converter/NumberConverterInterface.php
872 /modules/ps_accounts/vendor/ramsey/uuid/src/Builder/DefaultUuidBuilder.php
873 /modules/ps_accounts/vendor/ramsey/uuid/src/Builder/UuidBuilderInterface.php
874 /modules/ps_accounts/vendor/ramsey/uuid/src/Codec/StringCodec.php
875 /modules/ps_accounts/vendor/ramsey/uuid/src/Codec/CodecInterface.php
876 /modules/ps_accounts/vendor/ramsey/uuid/src/Provider/Node/FallbackNodeProvider.php
877 /modules/ps_accounts/vendor/ramsey/uuid/src/Provider/NodeProviderInterface.php
878 /modules/ps_accounts/vendor/ramsey/uuid/src/Provider/Node/SystemNodeProvider.php
879 /modules/ps_accounts/vendor/ramsey/uuid/src/Provider/Node/RandomNodeProvider.php
880 /modules/ps_accounts/vendor/ramsey/uuid/src/Generator/RandomGeneratorFactory.php
881 /modules/ps_accounts/vendor/ramsey/uuid/src/Generator/RandomBytesGenerator.php
882 /modules/ps_accounts/vendor/ramsey/uuid/src/Generator/RandomGeneratorInterface.php
883 /modules/ps_accounts/vendor/ramsey/uuid/src/Provider/Time/SystemTimeProvider.php
884 /modules/ps_accounts/vendor/ramsey/uuid/src/Provider/TimeProviderInterface.php
885 /modules/ps_accounts/vendor/ramsey/uuid/src/Generator/TimeGeneratorFactory.php
886 /modules/ps_accounts/vendor/ramsey/uuid/src/Converter/Time/PhpTimeConverter.php
887 /modules/ps_accounts/vendor/ramsey/uuid/src/Converter/TimeConverterInterface.php
888 /modules/ps_accounts/vendor/ramsey/uuid/src/Generator/DefaultTimeGenerator.php
889 /modules/ps_accounts/vendor/ramsey/uuid/src/Generator/TimeGeneratorInterface.php
890 /modules/ps_accounts/vendor/ramsey/uuid/src/BinaryUtils.php
891 /modules/ps_accounts/src/Service/OAuth2/CachedFile.php
892 /modules/ps_accounts/src/Account/Session/Firebase/ShopSession.php
893 /modules/ps_accounts/src/Account/Session/Firebase/FirebaseSession.php
894 /modules/ps_accounts/src/Account/Session/Firebase/OwnerSession.php
895 /modules/ps_accounts/src/Account/StatusManager.php
896 /modules/ps_accounts/src/Traits/WithOriginAndSourceTrait.php
897 /modules/ps_accounts/src/Traits/WithPropertyTrait.php
898 /modules/ps_accounts/src/Service/Accounts/AccountsService.php
899 /modules/ps_accounts/src/Service/AnalyticsService.php
900 /modules/ps_accounts/src/Service/AdminTokenService.php
901 /modules/ps_accounts/src/Adapter/ConfigurationKeys.php
902 /modules/ps_accounts/src/Account/CachedShopStatus.php
903 /modules/ps_accounts/src/Http/Resource/Resource.php
904 /modules/ps_accounts/src/Type/Dto.php
905 /modules/ps_accounts/src/Service/Accounts/Resource/ShopStatus.php
906 /modules/ps_facebook/vendor/sentry/sentry/lib/Raven/ErrorHandler.php
907 /modules/ps_facebook/classes/Dispatcher/EventDispatcher.php
908 /modules/ps_facebook/classes/Handler/ApiConversionHandler.php
909 /modules/ps_facebook/classes/Adapter/ConfigurationAdapter.php
910 /modules/ps_facebook/classes/Factory/ContextFactory.php
911 /modules/ps_facebook/classes/API/Client/FacebookClient.php
912 /modules/ps_facebook/classes/Factory/FacebookEssentialsApiClientFactory.php
913 /modules/ps_facebook/classes/Factory/ApiClientFactoryInterface.php
914 /modules/ps_facebook/classes/Provider/AccessTokenProvider.php
915 /modules/ps_facebook/classes/Factory/PsApiClientFactory.php
916 /modules/ps_facebook/classes/Handler/ConfigurationHandler.php
917 /modules/ps_facebook/classes/Http/HttpClient.php
918 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Api.php
919 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Session.php
920 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/SessionInterface.php
921 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/ApiConfig.php
922 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/Client.php
923 /modules/ps_facebook/classes/Handler/PixelHandler.php
924 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/MockFileSessionStorage.php
925 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/MockArraySessionStorage.php
926 /modules/ps_facebook/classes/Provider/EventDataProvider.php
927 /modules/ps_facebook/classes/Adapter/ToolsAdapter.php
928 /modules/ps_facebook/classes/Repository/ProductRepository.php
929 /modules/ps_facebook/classes/Provider/ProductAvailabilityProvider.php
930 /modules/ps_facebook/classes/Provider/ProductAvailabilityProviderInterface.php
931 /modules/ps_facebook/classes/Repository/GoogleCategoryRepository.php
932 /modules/ps_facebook/classes/Provider/GoogleCategoryProvider.php
933 /modules/ps_facebook/classes/Provider/GoogleCategoryProviderInterface.php
934 /classes/Combination.php
935 /classes/stock/StockAvailable.php
936 /classes/tax/Tax.php
937 /vendor/prestashop/decimal/src/DecimalNumber.php
938 /vendor/prestashop/decimal/src/Builder.php
939 /classes/SpecificPrice.php
940 /classes/tax/TaxManagerFactory.php
941 /classes/tax/TaxRulesTaxManager.php
942 /classes/tax/TaxManagerInterface.php
943 /classes/tax/TaxCalculator.php
944 /classes/GroupReduction.php
945 /src/Core/Localization/CLDR/ComputingPrecision.php
946 /src/Core/Localization/CLDR/ComputingPrecisionInterface.php
947 /classes/Pack.php
948 /classes/order/Order.php
949 /classes/Feature.php
950 /modules/ps_facebook/classes/Utility/ProductCatalogUtility.php
951 /src/Core/Util/String/StringModifier.php
952 /src/Core/Util/String/StringModifierInterface.php
953 /modules/ps_facebook/classes/Utility/CustomerInformationUtility.php
954 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/ServerSide/UserData.php
955 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/ServerSide/CustomData.php
956 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/ServerSide/Event.php
957 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/ServerSide/ActionSource.php
958 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Enum/AbstractEnum.php
959 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Enum/EnumInstanceInterface.php
960 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/ServerSide/EventRequest.php
961 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/ServerSide/HttpServiceClientConfig.php
962 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/ServerSide/Singleton.php
963 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/ServerSide/Util.php
964 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/ServerSide/Normalizer.php
965 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/AdsPixel.php
966 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/AbstractCrudObject.php
967 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/AbstractObject.php
968 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/Fields/AdsPixelFields.php
969 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/TypeChecker.php
970 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/Values/AdsPixelSortByValues.php
971 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/Values/AdsPixelAutomaticMatchingFieldsValues.php
972 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/Values/AdsPixelDataUseSettingValues.php
973 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/Values/AdsPixelFirstPartyCookieStatusValues.php
974 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/Values/AdsPixelPermittedTasksValues.php
975 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/Values/AdsPixelTasksValues.php
976 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/ApiRequest.php
977 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/RequestInterface.php
978 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Enum/EmptyEnum.php
979 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/Request.php
980 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/Parameters.php
981 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Logger/NullLogger.php
982 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Logger/LoggerInterface.php
983 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/Adapter/CurlAdapter.php
984 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/Adapter/AbstractAdapter.php
985 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/Adapter/AdapterInterface.php
986 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/Adapter/Curl/AbstractCurl.php
987 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/Adapter/Curl/CurlInterface.php
988 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/Adapter/Curl/Curl55.php
989 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/Response.php
990 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/ResponseInterface.php
991 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Http/Headers.php
992 /modules/ps_facebook/vendor/facebook/php-business-sdk/src/FacebookAds/Object/ServerSide/EventResponse.php
993 /vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php
994 /var/cache/prod/smarty/compile/warehouse/7b/d6/67/7bd6674da24c9dfe787a4ab6d9f95992772bfd39_2.file.header.tpl.php
995 /vendor/smarty/smarty/libs/plugins/modifier.escape.php
996 /var/cache/prod/smarty/compile/warehouse/e4/c2/28/e4c22868c11d8c62c1db61f765dd994d1dfa43b9_2.file.fbTrack.tpl.php
997 /modules/psxmarketingwithgoogle/psxmarketingwithgoogle.php
998 /modules/psxmarketingwithgoogle/translations/es.php
999 /var/cache/prod/PsxmarketingwithgoogleFrontContainer.php
1000 /modules/psxmarketingwithgoogle/classes/Adapter/ConfigurationAdapter.php
1001 /modules/psxmarketingwithgoogle/classes/Factory/ContextFactory.php
1002 /modules/psxmarketingwithgoogle/classes/config/Config.php
1003 /modules/psxmarketingwithgoogle/classes/Handler/RemarketingHookHandler.php
1004 /modules/psxmarketingwithgoogle/classes/Buffer/TemplateBuffer.php
1005 /modules/iqitcookielaw/iqitcookielaw.php
1006 /modules/iqitcookielaw/translations/es.php
1007 /modules/iqitmegamenu/iqitmegamenu.php
1008 /modules/iqitmegamenu/models/IqitMenuTab.php
1009 /modules/iqitmegamenu/models/IqitMenuHtml.php
1010 /modules/iqitmegamenu/models/IqitMenuLinks.php
1011 /modules/iqitmegamenu/translations/es.php
1012 /modules/iqitelementor/iqitelementor.php
1013 /modules/iqitelementor/src/IqitElementorLanding.php
1014 /modules/iqitelementor/src/IqitElementorTemplate.php
1015 /modules/iqitelementor/src/IqitElementorProduct.php
1016 /modules/iqitelementor/src/IqitElementorCategory.php
1017 /modules/iqitelementor/src/IqitElementorContent.php
1018 /modules/iqitelementor/src/iqitElementorWpHelper.php
1019 /modules/iqitelementor/includes/plugin-elementor.php
1020 /modules/iqitelementor/src/widgets/IqitElementorWidget_Brands.php
1021 /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsList.php
1022 /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsListTabs.php
1023 /modules/iqitelementor/src/widgets/IqitElementorWidget_Modules.php
1024 /modules/iqitelementor/src/widgets/IqitElementorWidget_CustomTpl.php
1025 /modules/iqitelementor/src/widgets/IqitElementorWidget_Menu.php
1026 /modules/iqitelementor/src/widgets/IqitElementorWidget_RevolutionSlider.php
1027 /modules/iqitelementor/src/widgets/IqitElementorWidget_Newsletter.php
1028 /modules/iqitelementor/src/widgets/IqitElementorWidget_Blog.php
1029 /modules/iqitelementor/src/widgets/IqitElementorWidget_Search.php
1030 /modules/iqitelementor/src/widgets/IqitElementorWidget_Links.php
1031 /modules/iqitelementor/src/widgets/IqitElementorWidget_ContactForm.php
1032 /modules/iqitelementor/translations/es.php
1033 /modules/nacex/nacex.php
1034 /modules/nacex/nacexWS.php
1035 /modules/nacex/nacexDTO.php
1036 /modules/nacex/AdminConfig.php
1037 /modules/nacex/UserGuide.php
1038 /modules/nacex/VInewServices.php
1039 /modules/nacex/nacexutils.php
1040 /modules/nacex/LBnewService.php
1041 /modules/nacex/nacexDAO.php
1042 /modules/nacex/ROnacexshop.php
1043 /modules/nacex/tratardatos.php
1044 /modules/nacex/nacexVIEW.php
1045 /modules/nacex/hash.php
1046 /classes/module/CarrierModule.php
1047 /modules/nacex/translations/es.php
1048 /src/Core/Product/Search/ProductSearchContext.php
1049 /src/Core/Product/Search/ProductSearchQuery.php
1050 /src/Core/Product/Search/SortOrder.php
1051 /modules/ps_facetedsearch/ps_facetedsearch.php
1052 /modules/ps_facetedsearch/src/HookDispatcher.php
1053 /modules/ps_facetedsearch/src/Hook/Attribute.php
1054 /modules/ps_facetedsearch/src/Hook/AbstractHook.php
1055 /modules/ps_facetedsearch/src/Hook/AttributeGroup.php
1056 /modules/ps_facetedsearch/src/Hook/Category.php
1057 /modules/ps_facetedsearch/src/Hook/Configuration.php
1058 /modules/ps_facetedsearch/src/Hook/Design.php
1059 /modules/ps_facetedsearch/src/Hook/Feature.php
1060 /modules/ps_facetedsearch/src/Form/Feature/FormModifier.php
1061 /modules/ps_facetedsearch/src/Form/Feature/FormDataProvider.php
1062 /modules/ps_facetedsearch/src/Hook/FeatureValue.php
1063 /modules/ps_facetedsearch/src/Form/FeatureValue/FormModifier.php
1064 /modules/ps_facetedsearch/src/Form/FeatureValue/FormDataProvider.php
1065 /modules/ps_facetedsearch/src/Hook/Product.php
1066 /modules/ps_facetedsearch/src/Hook/ProductSearch.php
1067 /modules/ps_facetedsearch/src/Hook/SpecificPrice.php
1068 /modules/ps_facetedsearch/src/Filters/Provider.php
1069 /modules/ps_facetedsearch/src/URLSerializer.php
1070 /modules/ps_facetedsearch/src/Filters/DataAccessor.php
1071 /modules/ps_facetedsearch/src/Product/SearchProvider.php
1072 /src/Core/Product/Search/FacetsRendererInterface.php
1073 /src/Core/Product/Search/ProductSearchProviderInterface.php
1074 /modules/ps_facetedsearch/src/Filters/Converter.php
1075 /modules/ps_facetedsearch/src/Product/SearchFactory.php
1076 /src/Core/Product/Search/ProductSearchResult.php
1077 /modules/ps_facetedsearch/src/Product/Search.php
1078 /modules/ps_facetedsearch/src/Adapter/MySQL.php
1079 /modules/ps_facetedsearch/src/Adapter/AbstractAdapter.php
1080 /modules/ps_facetedsearch/src/Adapter/InterfaceAdapter.php
1081 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ArrayCollection.php
1082 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Collection.php
1083 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ReadableCollection.php
1084 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Selectable.php
1085 /modules/ps_facetedsearch/src/Filters/Products.php
1086 /modules/ps_facetedsearch/src/Filters/Block.php
1087 /src/Core/Product/Search/Facet.php
1088 /src/Core/Product/Search/Filter.php
1089 /src/Core/Product/Search/FacetCollection.php
1090 /classes/ProductAssembler.php
1091 /classes/Manufacturer.php
1092 /classes/ProductPresenterFactory.php
1093 /src/Adapter/Presenter/Product/ProductListingPresenter.php
1094 /src/Adapter/Presenter/Product/ProductPresenter.php
1095 /src/Adapter/Product/ProductColorsRetriever.php
1096 /src/Core/Product/ProductPresentationSettings.php
1097 /src/Adapter/Presenter/Product/ProductListingLazyArray.php
1098 /src/Adapter/Presenter/Product/ProductLazyArray.php
1099 /classes/Image.php
1100 /var/cache/prod/smarty/compile/warehouse/d4/1d/65/d41d65d76b9471b5d365fe06cf1737c89a53af9f_2.module.ps_facetedsearchviewstemplatesfrontcatalogfacets.tpl.php
1101 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_block.php
1102 /vendor/smarty/smarty/libs/plugins/modifier.count.php
1103 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php
1104 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_foreach.php
1105 /var/cache/prod/smarty/compile/warehouse/2e/80/73/2e807335546cfa2360c36327ac89dd2fcb054379_2.module.ps_facetedsearchviewstemplatesfrontcatalogactivefilters.tpl.php
1106 /src/Core/Product/Search/Pagination.php
1107 /vendor/defuse/php-encryption/src/Crypto.php
1108 /vendor/defuse/php-encryption/src/KeyOrPassword.php
1109 /vendor/defuse/php-encryption/src/RuntimeTests.php
1110 /vendor/defuse/php-encryption/src/DerivedKeys.php
1111 /vendor/defuse/php-encryption/src/Exception/WrongKeyOrModifiedCiphertextException.php
1112 /vendor/defuse/php-encryption/src/Exception/CryptoException.php
1113 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/75/a6/42/75a64202e97931196bc7ffc62f78ffd65260f53c_2.file.category.tpl.php
1114 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_capture.php
1115 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/94/12/cc/9412ccef9680927153b45c6ae144d544996206b6_2.file.product-list.tpl.php
1116 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/b9/42/2f/b9422fde64d87165f5f5c624a4cbefbe5f5cc591_2.file.layout-left-column.tpl.php
1117 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/d2/95/d8/d295d85097e23dfc619a6d9948f9bb0871953825_2.file.layout-both-columns.tpl.php
1118 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/48/f1/3f/48f13f505ce53fe1a91e5a59ff252495434ac43d_2.file.helpers.tpl.php
1119 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_tplfunction.php
1120 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/1b/22/bc/1b22bcae0a59cc6b48cc1c9c25235f501651e518_2.file.head.tpl.php
1121 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/41/92/2e/41922ed228227013af99527db113ad08c91d4c9b_2.file.head-jsonld.tpl.php
1122 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/e2/41/5c/e2415c4af2ebd285942a955984af4b4e1aa22189_2.file.product-list-jsonld.tpl.php
1123 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/04/1b/47/041b4759bcd23a9de0adfa67f3a43b8b64636a07_2.file.pagination-seo.tpl.php
1124 /vendor/smarty/smarty/libs/plugins/modifier.replace.php
1125 /vendor/smarty/smarty/libs/plugins/shared.mb_str_replace.php
1126 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/43/32/e4/4332e4a9374e52ec03407d255e0717700fe0ae38_2.file.stylesheets.tpl.php
1127 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/ad/11/eb/ad11ebbbe1d132c2eb222c363cd04b3dee98d8fb_2.file.javascript.tpl.php
1128 /classes/ProductDownload.php
1129 /src/Core/Cart/Calculator.php
1130 /src/Core/Cart/CartRowCollection.php
1131 /src/Core/Cart/Fees.php
1132 /src/Core/Cart/AmountImmutable.php
1133 /src/Core/Cart/CartRuleCollection.php
1134 /src/Core/Cart/CartRuleCalculator.php
1135 /src/Adapter/Product/PriceCalculator.php
1136 /src/Core/Cart/CartRow.php
1137 /vendor/symfony/symfony/src/Symfony/Component/Translation/PluralizationRules.php
1138 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/b3/9c/46/b39c46fe99acdbe1574e9b876a398a0024152c16_2.file.product-activation.tpl.php
1139 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/da/79/cf/da79cf6aab6675d177369043b59a83d42869b4f0_2.file.header.tpl.php
1140 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/6a/a2/df/6aa2dfd27b196571f30e719112e04b70f089f033_2.file.social-links.tpl.php
1141 /modules/iqitlinksmanager/iqitlinksmanager.php
1142 /modules/iqitlinksmanager/src/IqitLinkBlockRepository.php
1143 /modules/iqitlinksmanager/src/IqitLinkBlock.php
1144 /modules/iqitlinksmanager/src/IqitLinkBlockPresenter.php
1145 /modules/iqitlinksmanager/translations/es.php
1146 /vendor/smarty/smarty/libs/sysplugins/smarty_template_cached.php
1147 /vendor/smarty/smarty/libs/sysplugins/smarty_cacheresource.php
1148 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_cacheresource_file.php
1149 /var/cache/prod/smarty/cache/iqitlinksmanager/1/1/1/6/displayNav1/warehouse/00/9f/22/009f22a54fda4ac75973e63c46f0132b1119ba03.iqitlinksmanagerviewstemplateshookiqitlinksmanager.tpl.php
1150 /modules/ps_languageselector/ps_languageselector.php
1151 /modules/ps_currencyselector/ps_currencyselector.php
1152 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/08/d5/04/08d504d7a022befca93803f3e17505b861ca8248_2.file.header-3.tpl.php
1153 /modules/iqitsearch/iqitsearch.php
1154 /modules/iqitsearch/translations/es.php
1155 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_gettemplatevars.php
1156 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/d9/9b/94/d99b947421dcff226f28b1d6cb674c91f17399db_2.module.iqitsearchviewstemplateshookiqitsearchbtn.tpl.php
1157 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/46/29/db/4629dbb3c4efa13c090c633dc2e46e5f2b42bed3_2.module.iqitsearchviewstemplateshooksearchbar.tpl.php
1158 /modules/ps_customersignin/ps_customersignin.php
1159 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/72/be/19/72be192e406191c1cad554abe284e159adeb4234_2.module.ps_customersigninps_customersigninbtn.tpl.php
1160 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/b4/a4/76/b4a476e0a8201677b298f7c0f8ca1ac698e1bac3_2.module.ps_shoppingcartps_shoppingcartbtn.tpl.php
1161 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/35/65/5e/35655e6409b6198f29dd6e732ef9598dec599880_2.module.ps_shoppingcartps_shoppingcart.tpl.php
1162 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/f6/e9/f2/f6e9f2b1680a466582d2199d038efe2cfa3a83f7_2.module.ps_shoppingcartps_shoppingcartcontent.tpl.php
1163 /var/cache/prod/smarty/cache/iqitmegamenu/index/1/1/1/6/warehouse/0e/3d/e6/0e3de6994bee6e3198146e208ce6beab444c9b4c.iqitmegamenuviewstemplateshookhorizontal.tpl.php
1164 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/cc/19/65/cc196527306127f5e0d92c634bf0405f2119a661_2.file.mobile-header-2.tpl.php
1165 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/7a/30/38/7a3038780284d52e9fcd7a66e51e5b86a166106b_2.module.iqitsearchviewstemplateshooksearchbarmobile.tpl.php
1166 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/be/ee/e6/beeee6f3d87613010f8af1cabc4c4562f8cf600a_2.module.ps_customersigninps_customersigninmobile.tpl.php
1167 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/d4/e1/57/d4e1571b6b210795247564db06deb17061778b51_2.module.ps_shoppingcartps_shoppingcartmqty.tpl.php
1168 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/90/d8/0a/90d80a9022c08011c7d753c6c3e409a4ae5b7fda_2.file.breadcrumb.tpl.php
1169 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/19/19/82/191982fa1e9d343688d9b381fea21c314a7ebef3_2.file.notifications.tpl.php
1170 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/3f/08/79/3f087969496cb1217bbe01ca6f95bbcaae18b1cf_2.file.category-header.tpl.php
1171 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/3e/fc/5c/3efc5c6cabf68a518dde9956926db6cf60a93dd5_2.file.products-top.tpl.php
1172 /vendor/smarty/smarty/libs/plugins/modifier.regex_replace.php
1173 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/5e/be/46/5ebe46ba384c4e31c6497e544847aec50e2df7ed_2.file.sort-orders.tpl.php
1174 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/df/95/52/df9552fec00c67a219e4d30c27efc6f3e649e435_2.file.products.tpl.php
1175 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/55/7a/be/557abe380aacf1dcc82a9614401a41c90059c373_2.file.product.tpl.php
1176 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/83/21/1d/83211d3e18c7848aecc64c18474f33bc0ea7cd65_2.file.product-miniature-1.tpl.php
1177 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/0a/d6/ba/0ad6ba9370f144df31a3308c307c61383af0f46f_2.file.product-miniature-thumb.tpl.php
1178 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/54/f1/31/54f131cbfede74c5ff970f4d07b4366036e2f8db_2.file.product-miniature-btn.tpl.php
1179 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/c2/18/5e/c2185e235e559bf004db69cd2c6a7703df41adb0_2.file.pagination.tpl.php
1180 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/5e/fc/91/5efc91d7387e3670df18e3cf6645652c4546f7c9_2.file.products-bottom.tpl.php
1181 /var/cache/prod/smarty/compile/warehouse/81/a1/04/81a1040ed0eeab6f58198f9907167c7fced628c5_2.module.ps_facetedsearchps_facetedsearch.tpl.php
1182 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/36/7c/da/367cdad5e95c9d0937b2526e141cbe7cc11d72f9_2.file.footer.tpl.php
1183 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/2c/ca/be/2ccabe66f524058310a6818abce4e6d56ee1bb64_2.file.footer-1.tpl.php
1184 /var/cache/prod/smarty/cache/iqitlinksmanager/1/1/1/6/displayFooter/warehouse/00/9f/22/009f22a54fda4ac75973e63c46f0132b1119ba03.iqitlinksmanagerviewstemplateshookiqitlinksmanager.tpl.php
1185 /modules/corewhatsapp/corewhatsapp.php
1186 /modules/corewhatsapp/classes/Corewhatsapp.php
1187 /var/cache/prod/smarty/compile/warehouse/f3/d9/ed/f3d9ed074127cff4b22b15d975f7cd788fe3a35d_2.file.corewhatsapp.tpl.php
1188 /var/cache/prod/smarty/compile/warehouse/30/7d/c6/307dc6bd4724d29d1572cc301dd7148e962604ef_2.module.ps_emailsubscriptionviewstemplateshookps_emailsubscription.tpl.php
1189 /modules/psgdpr/psgdpr.php
1190 /modules/psgdpr/translations/es.php
1191 /modules/psgdpr/classes/GDPRConsent.php
1192 /var/cache/prod/smarty/compile/warehouse/5e/ee/24/5eee242e5cbca9bb89b8ffa439cebef7beaaf2e4_2.module.psgdprviewstemplateshookdisplayGDPRConsent.tpl.php
1193 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/94/7d/69/947d69d2647da7c0eeb75ef9497030be726dc5dc_2.file.footer-copyrights-1.tpl.php
1194 /var/cache/prod/smarty/compile/warehouselayouts_layout_left_column_tpl/ef/d8/5e/efd85eed67e0be9a97e7376c50dacb5344f76046_2.file.password-policy-template.tpl.php
1195 /var/cache/prod/smarty/cache/iqitcookielaw/1/1/1/6/warehouse/e7/7b/d0/e77bd029c1dc3735e3f4798f608cdf3e90a317c6.iqitcookielawviewstemplateshookiqitcookielaw.tpl.php
1196 /modules/statsdata/statsdata.php
1197 /classes/Guest.php
1198 /classes/Connection.php
1199 /classes/Page.php
1200 /classes/ConnectionsSource.php